{ "uniprot_canonical_ac": "Q99210-1", "uniprot_ac": "Q99210", "uniprot_id": "NTPPA_YEAST", "mass": { "chemical_mass": 26477.0, "monoisotopic_mass": 26477.0 }, "refseq": { "ac": "NP_014754", "name": "nucleotide diphosphatase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014754" }, "gene_names": [ { "name": "O3237", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q99210", "id": "Q99210" }, { "name": "YOR3237W", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q99210", "id": "Q99210" } ], "protein_names": [ { "name": "dTTP/UTP pyrophosphatase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q99210" }, { "name": "3.6.1.9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q99210" }, { "name": "Maf-like protein YOR111W", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q99210" }, { "name": "Nucleoside triphosphate pyrophosphatase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q99210" }, { "name": "Nucleotide PPase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q99210" }, { "name": "Nucleotide pyrophosphatase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q99210" }, { "name": "dTTPase/UTPase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q99210" }, { "name": "nucleotide diphosphatase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014754", "id": "NP_014754" } ], "function": [ { "annotation": "Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. Can also hydrolyze the modified nucleotides 5-methyl-UTP (m(5)UTP) and pseudo-UTP. Has weak activity with CTP (PubMed:24210219). May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids (PubMed:24210219).", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210#function" }, { "database": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 103, "end_pos": 103, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" }, { "database": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] }, { "start_pos": 104, "end_pos": 104, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" }, { "database": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] }, { "start_pos": 115, "end_pos": 115, "sequence_org": "E", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" }, { "database": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] }, { "start_pos": 116, "end_pos": 116, "sequence_org": "K", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" }, { "database": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] }, { "start_pos": 188, "end_pos": 188, "sequence_org": "E", "sequence_mut": "A", "comment": "Decrease in activity.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" }, { "database": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] }, { "start_pos": 193, "end_pos": 193, "sequence_org": "F", "sequence_mut": "A", "comment": "Decrease in activity.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" }, { "database": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] }, { "start_pos": 194, "end_pos": 194, "sequence_org": "K", "sequence_mut": "A", "comment": "No change in activity.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" }, { "database": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] }, { "start_pos": 196, "end_pos": 196, "sequence_org": "Q", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" }, { "database": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] }, { "start_pos": 196, "end_pos": 196, "sequence_org": "Q", "sequence_mut": "E", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" }, { "database": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] }, { "start_pos": 25, "end_pos": 25, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" }, { "database": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] }, { "start_pos": 26, "end_pos": 26, "sequence_org": "T", "sequence_mut": "A", "comment": "No change in activity.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" }, { "database": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] }, { "start_pos": 29, "end_pos": 29, "sequence_org": "R", "sequence_mut": "A", "comment": "No change in activity.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" }, { "database": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] }, { "start_pos": 30, "end_pos": 30, "sequence_org": "R", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" }, { "database": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] }, { "start_pos": 66, "end_pos": 66, "sequence_org": "Y", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" }, { "database": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] }, { "start_pos": 74, "end_pos": 74, "sequence_org": "K", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" }, { "database": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] }, { "start_pos": 76, "end_pos": 76, "sequence_org": "Q", "sequence_mut": "A", "comment": "No change in activity.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" }, { "database": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] }, { "start_pos": 77, "end_pos": 77, "sequence_org": "N", "sequence_mut": "A", "comment": "No change in activity.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" }, { "database": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" } ], "common_name": "Yeast" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/Q99210", "locus": {} } ], "crossref": [ { "id": "cd00555", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00555", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "854278", "url": "https://www.ncbi.nlm.nih.gov/gene/854278", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q99210", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q99210*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003697", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003697", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029001", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029001", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YOR111W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YOR111W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "VIGCDSV", "url": "https://omabrowser.org/oma/group/VIGCDSV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "458693at2759", "url": "http://www.orthodb.org/?query=458693at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43213", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43213", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43213:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43213:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02545", "url": "http://pfam.xfam.org/family/PF02545", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q99210", "url": "http://purl.obolibrary.org/obo/PR_Q99210", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_014754", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014754", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000005637", "url": "https://www.yeastgenome.org/locus/S000005637", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q99210-1", "url": "https://www.uniprot.org/uniprot/Q99210-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSGNSQLPPDVIGFICSKYDIILASTSPRRYEILHDIMGITDLKTMVSTFEENLDKMNYSTDPIGYVCDTSWHKAQNIIEILTDYEDENPNEIDKPKLIICADTIIIDKSGRIYEKPKTKEVQKKFLMKFCYEDDEPVNVVTAVTLIKWYGRENFELVPFRDETKVYFDNKIPLRILEEYVESGDGLEVGGGFKIQGQGAILIEKIEGDYYNVVGLPLNKTFKGLYAEANSI", "length": 232, "header": "sp|Q99210-1|NTPPA_YEAST Isoform 1 of dTTP/UTP pyrophosphatase OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=1 SV=1 CANONICAL=Q99210-1" }, "isoforms": [ { "isoform_ac": "Q99210-1", "url": "", "sequence": { "sequence": "MSGNSQLPPDVIGFICSKYDIILASTSPRRYEILHDIMGITDLKTMVSTFEENLDKMNYSTDPIGYVCDTSWHKAQNIIEILTDYEDENPNEIDKPKLIICADTIIIDKSGRIYEKPKTKEVQKKFLMKFCYEDDEPVNVVTAVTLIKWYGRENFELVPFRDETKVYFDNKIPLRILEEYVESGDGLEVGGGFKIQGQGAILIEKIEGDYYNVVGLPLNKTFKGLYAEANSI", "length": 232, "header": "sp|Q99210-1|NTPPA_YEAST Isoform 1 of dTTP/UTP pyrophosphatase OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=1 SV=1 CANONICAL=Q99210-1" }, "locus": { "chromosome": "XV", "start_pos": 531124, "end_pos": 530429, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YOR111W_mRNA", "url": "https://www.ensembl.org/id/YOR111W_mRNA" }, { "database": "Ensembl Peptide", "id": "YOR111W", "url": "https://www.ensembl.org/id/YOR111W" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "Biochemical and structural studies of conserved Maf proteins revealed nucleotide pyrophosphatases with a preference for modified nucleotides.", "journal": "Chem. Biol.", "date": "2013", "authors": "Tchigvintsev A, Tchigvintsev D, Flick R, Popovic A, Dong A, Xu X, Brown G, Lu W, Wu H, Cui H, Dombrowski L, Joo JC, Beloglazova N, Min J, Savchenko A, Caudy AA, Rabinowitz JD, Murzin AG, Yakunin AF", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" } ], "reference": [ { "type": "PubMed", "id": "24210219", "url": "https://glygen.org/publication/PubMed/24210219" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Sequencing and analysis of 51 kb on the right arm of chromosome XV from Saccharomyces cerevisiae reveals 30 open reading frames.", "journal": "Yeast", "date": "1996", "authors": "Ansorge W., Wiemann S., Zimmermann J., Benes V., Vlcek C., Paces V., Schwager C., Voss H., Erfle H., Stegemann J., Rechmann S.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" } ], "reference": [ { "type": "PubMed", "id": "8904341", "url": "https://glygen.org/publication/PubMed/8904341" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Mewes H.-W., Wambutt R., Wedler H., Wiemann S., Pujol A., Uhlen M., Camasses A., Poch O., Benes V., Durand P., Vlcek C., Winsor B., Landt O., Portetelle D., Casas C., Lafuente M.J., Paces V., Delius H., Michaux G., Schweizer M., Feldmann H., Kleine K., Martin R.P., Hofmann B., Schwager C., Voss H., Cziepluch C., Jauniaux J.-C., Hughes B., Galisson F., Volckaert G., Hattenhorst U., Cheret G., Sor F., Herrero E., Arino J., Vetter I., Casamayor A., Bordonne R., Perrin A., Thierry A., Kordes E., Louis E.J., Hollenberg C.P., Maarse A.C., Marck C., Vandenbol M., Pohl T.M., Tobiasch E., Pearson B.M., Poirey R., Hand N.J., Goulding S.E., Daignan-Fornier B., Dujon B., Goffeau A., Grivell L.A., Hani J., Hernando Y., Hilger F., Madania A., Mannhaupt G., Zollner A., Aldea M., Alexandraki D., Bolotin-Fukuhara M., Fairhead C., Gancedo C., Purnelle B., Ramezani Rad M., Tarassov I.A., Tzermia M., Voet M., Albermann K., Bohn C., Boyer J., Dang V.-D., Gaillon L., Gamo F.-J., Habbig B., Hebling U., Heumann K., Hiesel R., Kalogeropoulos A., Katsoulou C., Parle-McDermott A.G., Pettersson B., Rechmann S., Sterky F., Teodoru C., Tettelin H., Unseld M., Valens M., Wolfe K.H., Zumstein E., de Haan M.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" } ], "reference": [ { "type": "PubMed", "id": "9169874", "url": "https://glygen.org/publication/PubMed/9169874" } ] }, { "title": "DNA sequencing and analysis of 130 kb from yeast chromosome XV.", "journal": "Yeast", "date": "1997", "authors": "Ansorge W., Benes V., Sander C., Paces V., Valencia A., Schwager C., Voss H., Andrade M.A., Rechmann S., Teodoru C.", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" } ], "reference": [ { "type": "PubMed", "id": "9200815", "url": "https://glygen.org/publication/PubMed/9200815" } ] } ], "pathway": [ { "id": "sce:YOR111W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YOR111W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "nucleotide metabolic process", "id": "GO:0009117", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009117", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "nucleoside triphosphate diphosphatase activity", "id": "GO:0047429", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047429", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" } ], "pmid": "" }, { "name": "UTP diphosphatase activity", "id": "GO:0036221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036221", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" } ], "pmid": "" }, { "name": "dTTP diphosphatase activity", "id": "GO:0036218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036218", "evidence": [ { "database": "UniProtKB", "id": "Q99210", "url": "https://www.uniprot.org/uniprot/Q99210" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 219, "end_pos": 221, "annotation": "n_glycosylation_sequon" }, { "start_pos": 58, "end_pos": 60, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "28534", "name": "", "equation": "dTTP + H2O = diphosphate + dTMP + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O95671-1", "Q99210-1" ], "evidence": [ { "id": "28534", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/28534" } ] }, { "id": "29395", "name": "", "equation": "H2O + UTP = diphosphate + H(+) + UMP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q924C3-1", "O95671-1", "P22413-1", "P06802-1", "Q99210-1" ], "evidence": [ { "id": "29395", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/29395" } ] }, { "id": "58736", "name": "", "equation": "H2O + TTP = 5-methyl-UMP + diphosphate + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O95671-1", "Q99210-1" ], "evidence": [ { "id": "58736", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/58736" } ] }, { "id": "58740", "name": "", "equation": "H2O + psi-UTP = diphosphate + H(+) + psi-UMP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O95671-1", "Q99210-1" ], "evidence": [ { "id": "58740", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/58740" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "O95671", "gene_name": "ASMTL", "activity": [ { "ec_number": "3.6.1.9", "activity": "CTP + H2O = CMP + diphosphate + H(+).", "evidence": [ { "id": "O95671", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95671" } ] }, { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "O95671", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95671" } ] } ] }, { "uniprot_ac": "P06802", "gene_name": "Enpp1", "activity": [ { "ec_number": "3.1.4.1", "activity": "Hydrolytically removes 5'-nucleotides successively from the 3'-hydroxy termini of 3'-hydroxy-terminated oligonucleotides.", "evidence": [ { "id": "P06802", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06802" } ] }, { "ec_number": "3.6.1.9", "activity": "CTP + H2O = CMP + diphosphate + H(+).", "evidence": [ { "id": "P06802", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06802" } ] } ] }, { "uniprot_ac": "P22413", "gene_name": "ENPP1", "activity": [ { "ec_number": "3.1.4.1", "activity": "Hydrolytically removes 5'-nucleotides successively from the 3'-hydroxy termini of 3'-hydroxy-terminated oligonucleotides.", "evidence": [ { "id": "P22413", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22413" } ] }, { "ec_number": "3.6.1.9", "activity": "CTP + H2O = CMP + diphosphate + H(+).", "evidence": [ { "id": "P22413", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22413" } ] } ] }, { "uniprot_ac": "Q924C3", "gene_name": "Enpp1", "activity": [ { "ec_number": "3.1.4.1", "activity": "Hydrolytically removes 5'-nucleotides successively from the 3'-hydroxy termini of 3'-hydroxy-terminated oligonucleotides.", "evidence": [ { "id": "Q924C3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q924C3" } ] }, { "ec_number": "3.6.1.9", "activity": "CTP + H2O = CMP + diphosphate + H(+).", "evidence": [ { "id": "Q924C3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q924C3" } ] } ] }, { "uniprot_ac": "Q99210", "gene_name": "", "activity": [ { "ec_number": "3.6.1.9", "activity": "CTP + H2O = CMP + diphosphate + H(+).", "evidence": [ { "id": "Q99210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99210" } ] }, { "ec_number": "3.6.1.9", "activity": "", "evidence": [ { "id": "Q99210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99210" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }