{ "uniprot_canonical_ac": "Q99020-1", "uniprot_ac": "Q99020", "uniprot_id": "ROAA_MOUSE", "mass": { "chemical_mass": 30831.0, "monoisotopic_mass": 30831.0 }, "refseq": { "ac": "NP_034578", "name": "heterogeneous nuclear ribonucleoprotein A/B isoform 2", "summary": "This gene encodes a protein with consensus RNA binding domains present in a number of other RNA binding proteins and a glycine-rich C-terminus. This gene overlaps in a tail-to-tail orientation the gene encoding alanine-glyoxylate aminotransferase 2-like 2. Some of the exons of this gene are interspersed with exons of alanine-glyoxylate aminotransferase 2-like 2. Two alternatively spliced transcript variants that encode distinct proteins have been described for this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034578" }, "gene_names": [ { "name": "Hnrnpab", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q99020", "id": "Q99020" }, { "name": "3010025C11Rik; CBF-A; Cgbfa; Hnrpab", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034578", "id": "NP_034578" }, { "name": "Cbf-a", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q99020", "id": "Q99020" }, { "name": "Cgbfa", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q99020", "id": "Q99020" }, { "name": "Hnrnpab", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034578", "id": "NP_034578" }, { "name": "Hnrpab", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q99020", "id": "Q99020" } ], "protein_names": [ { "name": "Heterogeneous nuclear ribonucleoprotein A/B", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q99020" }, { "name": "CArG-binding factor-A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q99020" }, { "name": "CBF-A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q99020" }, { "name": "S1 protein D2; hnRNP A/B; CArG-binding factor-A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001041526", "id": "NP_001041526" }, { "name": "heterogeneous nuclear ribonucleoprotein A/B isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001041526", "id": "NP_001041526" }, { "name": "heterogeneous nuclear ribonucleoprotein A/B isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034578", "id": "NP_034578" }, { "name": "hnRNP A/B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q99020" } ], "function": [ { "annotation": "Axonal mRNA binding of hnRNP A/B is crucial for axon targeting and maturation of olfactory sensory neurons.", "evidence": [ { "database": "RefSeq", "id": "NP_001041526", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001041526" }, { "database": "PubMed", "id": "37083330", "url": "https://glygen.org/publication/PubMed/37083330" }, { "database": "RefSeq", "id": "NP_034578", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034578" } ] }, { "annotation": "Scrutinized the motility of Hnrnpab(-/-) cells and confirmed that the decreases in both cell motility and Eps8 are restored by ectopically coexpressing both alternatively spliced Hnrnpab isoforms, therefore these variants are surprisingly nonredundant for cell motility.", "evidence": [ { "database": "RefSeq", "id": "NP_001041526", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001041526" }, { "database": "PubMed", "id": "30314980", "url": "https://glygen.org/publication/PubMed/30314980" }, { "database": "RefSeq", "id": "NP_034578", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034578" } ] }, { "annotation": "Structure and binding of CBF-A (AUF2)", "evidence": [ { "database": "RefSeq", "id": "NP_001041526", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001041526" }, { "database": "PubMed", "id": "12086581", "url": "https://glygen.org/publication/PubMed/12086581" }, { "database": "RefSeq", "id": "NP_034578", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034578" } ] }, { "annotation": "This gene encodes a protein with consensus RNA binding domains present in a number of other RNA binding proteins and a glycine-rich C-terminus. This gene overlaps in a tail-to-tail orientation the gene encoding alanine-glyoxylate aminotransferase 2-like 2. Some of the exons of this gene are interspersed with exons of alanine-glyoxylate aminotransferase 2-like 2. Two alternatively spliced transcript variants that encode distinct proteins have been described for this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001041526", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001041526" }, { "database": "RefSeq", "id": "NP_034578", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034578" } ] }, { "annotation": "Transcriptional repressor. Binds to CArG box motifs, single-stranded and double-stranded DNA, and RNA. It may be that repression by CBF-A is a result of competitive binding of CBF, a putative positive factor, and CBF-A to the same or overlapping motifs around the CArG boxes.", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020#function" } ] } ], "disease": [ { "disease_id": "DOID:0110306", "recommended_name": { "id": "DOID:0110306", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110306", "name": "autosomal dominant limb-girdle muscular dystrophy type 3", "description": "An autosomal dominant limb-girdle muscular dystrophy that has_material_basis_in heterozygous mutation in the HNRNPDL gene on chromosome 4q21." }, "synonyms": [ { "id": "DOID:0110306", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110306", "name": "LGMD1G", "description": "" }, { "id": "DOID:0110306", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110306", "name": "autosomal dominant limb-girdle muscular dystrophy type 1G", "description": "" }, { "id": "DOID:0110306", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110306", "name": "muscular dystrophy limb-girdle type 1G", "description": "" }, { "id": "MONDO:0012193", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012193", "name": "autosomal dominant limb-girdle muscular dystrophy type 1G", "description": "Autosomal dominant limb-girdle muscular dystrophy (LGMD1G) is a mild subtype of autosomal dominant limb-girdle muscular dystrophy characterized by a typically adult onset of mild, progressive, proximal weakness of pelvic and shoulder girdle muscles and progressive, permanent finger and toes flexion limitation without flexion contractures. Normal to highly elevated creatine kinase serum levels are observed." }, { "id": "MONDO:0012193", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012193", "name": "HNRNPDL autosomal dominant limb-girdle muscular dystrophy", "description": "" }, { "id": "MONDO:0012193", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012193", "name": "LGMD1G", "description": "" }, { "id": "MONDO:0012193", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012193", "name": "autosomal dominant limb-girdle muscular dystrophy caused by mutation in HNRNPDL", "description": "" }, { "id": "MONDO:0012193", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012193", "name": "muscular dystrophy limb-girdle type 1G", "description": "" }, { "id": "MONDO:0012193", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012193", "name": "muscular dystrophy, limb-girdle, autosomal dominant 3", "description": "" }, { "id": "MONDO:0012193", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012193", "name": "limb-girdle muscular dystrophy type 1G", "description": "" }, { "id": "MONDO:0012193", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012193", "name": "limb-girdle muscular dystrophy, type 1G", "description": "" }, { "id": "MIM:609115", "resource": "MIM", "url": "https://www.omim.org/entry/609115", "name": "Muscular dystrophy, limb-girdle, autosomal dominant 3", "description": "Muscular dystrophy, limb-girdle, autosomal dominant 3" } ], "evidence": [ { "id": "0110306", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0110306" } ] }, { "disease_id": "DOID:224", "recommended_name": { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "transient cerebral ischemia", "description": "A brain ischemia that is characterized by ischemia of brief duration and without resultant tissue death." }, "synonyms": [ { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "TIA", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "TIA - Transient ischaemic attack", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "Transient cerebral ischaemia", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "Transient ischemic attacks", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "transient ischemic attack", "description": "" } ], "evidence": [ { "id": "224", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:224" } ] }, { "disease_id": "DOID:684", "recommended_name": { "id": "DOID:684", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:684", "name": "hepatocellular carcinoma", "description": "A liver carcinoma that has_material_basis_in undifferentiated hepatocytes and located_in the liver." }, "synonyms": [ { "id": "DOID:684", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:684", "name": "Hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "A malignant tumor that arises from hepatocytes. Hepatocellular carcinoma is relatively rare in the United States but very common in all African countries south of the Sahara and in Southeast Asia. Most cases are seen in patients over the age of 50 years, but this tumor can also occur in younger individuals and even in children. Hepatocellular carcinoma is more common in males than females and is associated with hepatitis B, hepatitis C, chronic alcohol abuse and cirrhosis. Serum elevation of alpha-fetoprotein occurs in a large percentage of patients with hepatocellular carcinoma. Grossly, hepatocellular carcinoma may present as a single mass, as multiple nodules, or as diffuse liver involvement. Microscopically, there is a wide range of differentiation from tumor to tumor (well differentiated to poorly differentiated tumors). Hepatocellular carcinomas quickly metastasize to regional lymph nodes and lung. The overall median survival of untreated liver cell carcinoma is about 4 months. The most effective treatment of hepatocellular carcinoma is complete resection of the tumor. Lately, an increasing number of tumors have been treated with liver transplantation." }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "HCC", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "cancer, hepatocellular", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma, hepatocellular, malignant", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular adenocarcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, childhood type, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell cancer (hepatocellular carcinoma)", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult primary hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma caused by somatic mutation", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver and intrahepatic bile duct carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "A malignant tumor that arises from hepatocytes. Hepatocellular carcinoma is relatively rare in the United States but very common in all African countries south of the Sahara and in Southeast Asia. Most cases are seen in patients over the age of 50 years, but this tumor can also occur in younger individuals and even in children. Hepatocellular carcinoma is more common in males than females and is associated with hepatitis B, hepatitis C, chronic alcohol abuse and cirrhosis. Serum elevation of alpha-fetoprotein occurs in a large percentage of patients with hepatocellular carcinoma. Grossly, hepatocellular carcinoma may present as a single mass, as multiple nodules, or as diffuse liver involvement. Microscopically, there is a wide range of differentiation from tumor to tumor (well differentiated to poorly differentiated tumors). Hepatocellular carcinomas quickly metastasize to regional lymph nodes and lung. The overall median survival of untreated liver cell carcinoma is about 4 months. The most effective treatment of hepatocellular carcinoma is complete resection of the tumor. Lately, an increasing number of tumors have been treated with liver transplantation." }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "HCC", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "cancer, hepatocellular", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma, hepatocellular, malignant", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular adenocarcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, childhood type, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell cancer (hepatocellular carcinoma)", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult primary hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma caused by somatic mutation", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver and intrahepatic bile duct carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cancer", "description": "" }, { "id": "MIM:114550", "resource": "MIM", "url": "https://www.omim.org/entry/114550", "name": "Hepatocellular carcinoma", "description": "Hepatocellular carcinoma" } ], "evidence": [ { "id": "684", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:684" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Hnrnpab", "url": "https://www.uniprot.org/uniprot/Q99020", "locus": { "chromosome": "11", "start_pos": 51490927, "end_pos": 51497674, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000020358", "url": "https://www.ensembl.org/id/ENSMUSG00000020358" } ] } } ], "crossref": [ { "id": "ENSMUSG00000020358", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000020358", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd12584", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12584", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd12757", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12757", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "15384", "url": "https://www.ncbi.nlm.nih.gov/gene/15384", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q99020", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q99020*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012677", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012677", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012956", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012956", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034846", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034846", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:15384", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:15384", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1330294", "url": "http://www.informatics.jax.org/marker/MGI:1330294", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q99020", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q99020", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "DYNSDRG", "url": "https://omabrowser.org/oma/group/DYNSDRG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3127428at2759", "url": "http://www.orthodb.org/?query=3127428at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR48033", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48033", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48033:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48033:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00076", "url": "http://pfam.xfam.org/family/PF00076", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08143", "url": "http://pfam.xfam.org/family/PF08143", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q99020", "url": "http://purl.obolibrary.org/obo/PR_Q99020", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_034578", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034578", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q20BD0", "url": "https://www.uniprot.org/uniprot/Q20BD0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q20BD0-1", "url": "https://www.uniprot.org/uniprot/Q20BD0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q80XR6", "url": "https://www.uniprot.org/uniprot/Q80XR6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q80XR6-1", "url": "https://www.uniprot.org/uniprot/Q80XR6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q99020-1", "url": "https://www.uniprot.org/uniprot/Q99020-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSDAAEEQPMETTGATENGHEAAPEGEAPVEPSAAAAAPAASAGSGGGTTTAPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGQGSTNYGKSQRRGGHQNNYKPY", "length": 285, "header": "sp|Q99020-1|ROAA_MOUSE Isoform 1 of Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus OX=10090 GN=Hnrnpab PE=1 SV=1 CANONICAL=Q99020-1" }, "isoforms": [ { "isoform_ac": "Q20BD0-1", "url": "", "sequence": { "sequence": "MSDAAEEQPMETTGATENGHEAAPEGEAPVEPSAAAAAPAASAGSGGGTTTAPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSPYGYYGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPY", "length": 332, "header": "tr|Q20BD0-1|ROAA_MOUSE Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus OX=10090 GN=Hnrnpab PE=1 SV=1 CANONICAL=Q99020-1" }, "locus": { "chromosome": "11", "start_pos": 51497390, "end_pos": 51492238, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000109103.4", "url": "https://www.ensembl.org/id/ENSMUST00000109103.4" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000104731.4", "url": "https://www.ensembl.org/id/ENSMUSP00000104731.4" } ] } }, { "isoform_ac": "Q80XR6-1", "url": "", "sequence": { "sequence": "MSDAAEEQPMETTGATENGHEAAPEGEAPVEPSAAAAAPAASAGSGGGTTTAPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSPYGYYGYGPGYDYSK", "length": 311, "header": "tr|Q80XR6-1|ROAA_MOUSE Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus OX=10090 GN=Hnrnpab PE=1 SV=1 CANONICAL=Q99020-1" }, "locus": { "chromosome": "11", "start_pos": 51497390, "end_pos": 51492572, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000101249.9", "url": "https://www.ensembl.org/id/ENSMUST00000101249.9" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000098807.3", "url": "https://www.ensembl.org/id/ENSMUSP00000098807.3" } ] } }, { "isoform_ac": "Q99020-1", "url": "", "sequence": { "sequence": "MSDAAEEQPMETTGATENGHEAAPEGEAPVEPSAAAAAPAASAGSGGGTTTAPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGQGSTNYGKSQRRGGHQNNYKPY", "length": 285, "header": "sp|Q99020-1|ROAA_MOUSE Isoform 1 of Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus OX=10090 GN=Hnrnpab PE=1 SV=1 CANONICAL=Q99020-1" }, "locus": { "chromosome": "11", "start_pos": 51497390, "end_pos": 51492238, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000074669", "url": "https://www.ensembl.org/id/ENSMUST00000074669" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000074238", "url": "https://www.ensembl.org/id/ENSMUSP00000074238" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q99020", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q99020" }, { "id": "36288343", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36288343" } ] } ], "phosphorylation": [ { "start_pos": 247, "end_pos": 247, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "site_lbl": "Ser247" }, { "start_pos": 83, "end_pos": 83, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q99020", "url": "http://phospho.elm.eu.org/byAccession/Q99020.html" }, { "database": "iPTMnet", "id": "Q99020", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q99020" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" } ], "site_lbl": "Ser83" }, { "start_pos": 87, "end_pos": 87, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "site_lbl": "Ser87" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "S1 proteins C2 and D2 are novel hnRNPs similar to the transcriptional repressor, CArG box motif-binding factor A.", "journal": "Eur. J. Biochem.", "date": "2001", "authors": "Inoue A, Omori A, Ichinose S, Takahashi KP, Kinoshita Y, Mita S", "evidence": [ { "database": "UniProtKB", "id": "Q20BD0", "url": "https://www.uniprot.org/uniprot/Q20BD0" } ], "reference": [ { "type": "PubMed", "id": "11432731", "url": "https://glygen.org/publication/PubMed/11432731" } ] }, { "title": "Identification of a novel AU-rich-element-binding protein which is related to AUF1.", "journal": "The Biochemical journal", "date": "2002", "authors": "Dean JL, Sully G, Wait R, Rawlinson L, Clark AR, Saklatvala J", "evidence": [ { "database": "RefSeq", "id": "NP_001041526", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001041526" }, { "database": "RefSeq", "id": "NP_034578", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034578" } ], "reference": [ { "type": "PubMed", "id": "12086581", "url": "https://glygen.org/publication/PubMed/12086581" } ] }, { "title": "A protein binding to CArG box motifs and to single-stranded DNA functions as a transcriptional repressor.", "journal": "Gene", "date": "1992", "authors": "Kamada S., Miwa T.", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "reference": [ { "type": "PubMed", "id": "1398104", "url": "https://glygen.org/publication/PubMed/1398104" } ] }, { "title": "Large-scale phosphorylation analysis of mouse liver.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Villen J, Beausoleil SA, Gerber SA, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "Q99020", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q99020" } ], "reference": [ { "type": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" } ] }, { "title": "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.", "journal": "Mol. Cell", "date": "2013", "authors": "Park J, Chen Y, Tishkoff DX, Peng C, Tan M, Dai L, Xie Z, Zhang Y, Zwaans BM, Skinner ME, Lombard DB, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "Q20BD0", "url": "https://www.uniprot.org/uniprot/Q20BD0" }, { "database": "UniProtKB", "id": "Q80XR6", "url": "https://www.uniprot.org/uniprot/Q80XR6" }, { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "reference": [ { "type": "PubMed", "id": "23806337", "url": "https://glygen.org/publication/PubMed/23806337" } ] }, { "title": "Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.", "journal": "Mol. Cell. Proteomics", "date": "2014", "authors": "Guo A, Gu H, Zhou J, Mulhern D, Wang Y, Lee KA, Yang V, Aguiar M, Kornhauser J, Jia X, Ren J, Beausoleil SA, Silva JC, Vemulapalli V, Bedford MT, Comb MJ", "evidence": [ { "database": "UniProtKB", "id": "Q20BD0", "url": "https://www.uniprot.org/uniprot/Q20BD0" }, { "database": "UniProtKB", "id": "Q80XR6", "url": "https://www.uniprot.org/uniprot/Q80XR6" }, { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "reference": [ { "type": "PubMed", "id": "24129315", "url": "https://glygen.org/publication/PubMed/24129315" } ] }, { "title": "Hnrnpab regulates neural cell motility through transcription of Eps8.", "journal": "RNA (New York, N.Y.)", "date": "2019", "authors": "Lampasona AA, Czaplinski K", "evidence": [ { "database": "RefSeq", "id": "NP_034578", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034578" }, { "database": "RefSeq", "id": "NP_001041526", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001041526" } ], "reference": [ { "type": "PubMed", "id": "30314980", "url": "https://glygen.org/publication/PubMed/30314980" } ] }, { "title": "First comprehensive identification of cardiac proteins with putative increased O-GlcNAc levels during pressure overload hypertrophy.", "journal": "PloS one", "date": "2022", "authors": "Zhu Wei Zhong, Palazzo Teresa, Zhou Mowei, Ledee Dolena, Olson Heather M, Pa\u0161a-Toli\u0107 Ljiljana, Olson Aaron K", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q99020", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q99020" } ], "reference": [ { "type": "PubMed", "id": "36288343", "url": "https://glygen.org/publication/PubMed/36288343" } ] }, { "title": "Axonal mRNA binding of hnRNP A/B is crucial for axon targeting and maturation of olfactory sensory neurons.", "journal": "Cell reports", "date": "2023-04-20", "authors": "Fukuda Nanaho, Fukuda Tomoyuki, Percipalle Piergiorgio, Oda Kanako, Takei Nobuyuki, Czaplinski Kevin, Touhara Kazushige, Yoshihara Yoshihiro, Sasaoka Toshikuni", "evidence": [ { "database": "RefSeq", "id": "NP_001041526", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001041526" }, { "database": "RefSeq", "id": "NP_034578", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034578" } ], "reference": [ { "type": "PubMed", "id": "37083330", "url": "https://glygen.org/publication/PubMed/37083330" } ] } ], "pathway": [ { "id": "mmu:15384", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:15384", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A6HE59-1", "protein_name": "Heterogeneous nuclear ribonucleoprotein A/B", "gene_name": "Hnrnpab", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSDAAEEQPMETTGATENGHEAAPEGEAPVEPSPGAAAPATPAGSGGGTTAAPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSPYGYYGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPY", "length": 332 }, "evidence": [ { "id": "45235612", "url": "http://www.informatics.jax.org/homology/45235612", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q99729-1", "protein_name": "Heterogeneous nuclear ribonucleoprotein A/B", "gene_name": "HNRNPAB", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSEAGEEQPMETTGATENGHEAVPEASRGRGWTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPESPTEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSPYGYYGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPY", "length": 332 }, "evidence": [ { "id": "45235612", "url": "http://www.informatics.jax.org/homology/45235612", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "regulation of cellular localization", "id": "GO:0060341", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060341", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "mRNA modification", "id": "GO:0016556", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016556", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "epithelial to mesenchymal transition", "id": "GO:0001837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001837", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "regulation of gene expression", "id": "GO:0010468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010468", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "positive regulation of DNA demethylation", "id": "GO:1901537", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901537", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay", "id": "GO:2000623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000623", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "regulation of intracellular mRNA localization", "id": "GO:1904580", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904580", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "cellular response to amino acid stimulus", "id": "GO:0071230", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071230", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "positive regulation of macromolecule metabolic process", "id": "GO:0010604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010604", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 10, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "RNA polymerase II transcription regulator complex", "id": "GO:0090575", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090575", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "messenger ribonucleoprotein complex", "id": "GO:1990124", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990124", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "neuronal ribonucleoprotein granule", "id": "GO:0071598", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071598", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "presynaptic cytosol", "id": "GO:0099523", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099523", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" }, { "name": "mRNA editing complex", "id": "GO:0045293", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045293", "evidence": [ { "database": "UniProtKB", "id": "Q99020", "url": "https://www.uniprot.org/uniprot/Q99020" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 66, "end_pos": 68, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }