{ "uniprot_canonical_ac": "Q96VH5-1", "uniprot_ac": "Q96VH5", "uniprot_id": "MIC10_YEAST", "mass": { "chemical_mass": 10408.0, "monoisotopic_mass": 10408.0 }, "refseq": { "ac": "NP_065435", "name": "Mic10p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_065435" }, "gene_names": [ { "name": "MIC10", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q96VH5", "id": "Q96VH5" }, { "name": "MCS10; MIO10; MOS1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_065435", "id": "NP_065435" }, { "name": "MCS10", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q96VH5", "id": "Q96VH5" }, { "name": "MIC10", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_065435", "id": "NP_065435" }, { "name": "MIO10", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q96VH5", "id": "Q96VH5" }, { "name": "MOS1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q96VH5", "id": "Q96VH5" } ], "protein_names": [ { "name": "MICOS complex subunit MIC10", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q96VH5" }, { "name": "Mic10p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_065435", "id": "NP_065435" }, { "name": "MitOS1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q96VH5" }, { "name": "Mitochondrial contact site complex 10 kDa subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q96VH5" }, { "name": "Mitochondrial inner membrane organization component of 10 kDa", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q96VH5" }, { "name": "Mitochondrial organizing structure protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q96VH5" } ], "function": [ { "annotation": "Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.", "evidence": [ { "database": "UniProtKB", "id": "Q96VH5", "url": "https://www.uniprot.org/uniprot/Q96VH5#function" }, { "database": "PubMed", "id": "21987634", "url": "https://glygen.org/publication/PubMed/21987634" }, { "database": "PubMed", "id": "22114354", "url": "https://glygen.org/publication/PubMed/22114354" }, { "database": "PubMed", "id": "21944719", "url": "https://glygen.org/publication/PubMed/21944719" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q96VH5", "url": "https://www.uniprot.org/uniprot/Q96VH5" } ], "common_name": "Yeast" } ], "gene": [ { "name": "MIC10", "url": "https://www.uniprot.org/uniprot/Q96VH5", "locus": {} } ], "crossref": [ { "id": "850300", "url": "https://www.ncbi.nlm.nih.gov/gene/850300", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q96VH5", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q96VH5*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR007512", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007512", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YCL057C-A", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YCL057C-A", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PIISAEW", "url": "https://omabrowser.org/oma/group/PIISAEW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2785547at2759", "url": "http://www.orthodb.org/?query=2785547at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21304", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21304", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21304:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21304:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04418", "url": "http://pfam.xfam.org/family/PF04418", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q96VH5", "url": "http://purl.obolibrary.org/obo/PR_Q96VH5", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_065435", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_065435", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000007547", "url": "https://www.yeastgenome.org/locus/S000007547", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q96VH5", "url": "https://www.uniprot.org/uniprot/Q96VH5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q96VH5-1", "url": "https://www.uniprot.org/uniprot/Q96VH5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV", "length": 97, "header": "sp|Q96VH5-1|MIC10_YEAST Isoform 1 of MICOS complex subunit MIC10 OS=Saccharomyces cerevisiae S288C OX=559292 GN=MIC10 PE=1 SV=1 CANONICAL=Q96VH5-1" }, "isoforms": [ { "isoform_ac": "Q96VH5-1", "url": "", "sequence": { "sequence": "MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV", "length": 97, "header": "sp|Q96VH5-1|MIC10_YEAST Isoform 1 of MICOS complex subunit MIC10 OS=Saccharomyces cerevisiae S288C OX=559292 GN=MIC10 PE=1 SV=1 CANONICAL=Q96VH5-1" }, "locus": { "chromosome": "III", "start_pos": 24325, "end_pos": 24035, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YCL057C-A_mRNA", "url": "https://www.ensembl.org/id/YCL057C-A_mRNA" }, { "database": "Ensembl Peptide", "id": "YCL057C-A", "url": "https://www.ensembl.org/id/YCL057C-A" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q96VH5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q96VH5" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ], "site_lbl": "Ser2" } ], "glycation": [], "keywords": [], "publication": [ { "title": "The complete DNA sequence of yeast chromosome III.", "journal": "Nature", "date": "1992", "authors": "Duesterhoeft A., Mewes H.-W., Schweitzer B., Wang H., Brown A., Lanfranchi G., Rodriguez F., Valle G., Wilson C., Kelly A., Xu G., Huse K., Jia Y., Planta R.J., Vreken P., Benit P., Jacquet M., Plevani P., Hohmann S., Antoine G., Roberts A.B., Fukuhara H., Lewis C., Molemans F., Shu Y., Esteban M., Feldmann H., Delgado M.D., Isono K., Fiers W., Mallet L., Jimenez A., Jauniaux J.-C., Dubois E., Pallier C., Volckaert G., Lucchini G., Newlon C.S., Sor F., Faye G., Anwar R., Haasemann M., Iborra F., Slonimski P.P., Hoenicka J., Vetter I., Thierry A., Yoshikawa A., Hollenberg C.P., Contreras R., Philippsen P., Martegani E., Gigot D., Alberghina L., Hatat D., Brown A.J.P., James C.M., Pearson B.M., Mathieu A., Sanz E., Steiner S., Ballesta J.P.G., Buhler J.-M., Carignani G., Cederberg H., Crouzet M., Daignan-Fornier B., Dujon B., Gilliquet V., Glansdorff N., Goffeau A., Grenson M., Grivell L.A., Hegemann J.H., Herbert C.J., Hilger F., Jacq C., Mannhaupt G., Messenguy F., Muzi Falconi M., Oliver S.G., Perea J., Pierard A., Remacha M.A., Schaaff-Gerstenschlaeger I., Scherens B., Steensma H.Y., Wurst H., Zimmermann F.K., Alexandraki D., Berben G., Bolotin-Fukuhara M., Chanet R., Fabre F., Fairhead C., Frontali L., Purnelle B., Ramezani Rad M., Skala J., Tzermia M., Urrestarazu L.A., Voet M., Agostoni-Carbone M.L., Aigle M., Bergantino E., Biteau N., Bolle P.-A., Carcano C., Defoor E., Demolder J., Doira C., Erdmann D., Francingues-Gaillard M.-C., Franco L., Fuller L.J., Galland P., Gent M.E., Grisanti P., Indge K.J., Kleinhans U., Kreisl P., Lutzenkirchen K., Maat M.J., Maurer C.T.C., McConnell D., McKee R.A., Montague M.A., Navas L., Noone D., Panzeri L., Poetsch B., Pohl F.M., Rasmussen S.W., Raynal A., Richterich P., Sgouros J.G., Soustelle C., Spiegelberg R., Stateva L.I., Thireos G., Warmington J.R., Wicksteed B.L., de Haan M., van Vliet-Reedijk J.C., van der Aart Q.J.M., van der Linden C.G., von Wettstein D.", "evidence": [ { "database": "UniProtKB", "id": "Q96VH5", "url": "https://www.uniprot.org/uniprot/Q96VH5" } ], "reference": [ { "type": "PubMed", "id": "1574125", "url": "https://glygen.org/publication/PubMed/1574125" } ] }, { "title": "Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics.", "journal": "J. Proteome Res.", "date": "2006", "authors": "Sickmann A., Zahedi R.P., Meisinger C., Reinders J., Pfanner N.", "evidence": [ { "database": "UniProtKB", "id": "Q96VH5", "url": "https://www.uniprot.org/uniprot/Q96VH5" } ], "reference": [ { "type": "PubMed", "id": "16823961", "url": "https://glygen.org/publication/PubMed/16823961" } ] }, { "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.", "journal": "BMC genomics", "date": "2010-12-02", "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R", "evidence": [ { "database": "iPTMnet", "id": "Q96VH5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q96VH5" } ], "reference": [ { "type": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ] }, { "title": "Dual role of mitofilin in mitochondrial membrane organization and protein biogenesis.", "journal": "Dev. Cell", "date": "2011", "authors": "von der Malsburg K, Muller JM, Bohnert M, Oeljeklaus S, Kwiatkowska P, Becker T, Loniewska-Lwowska A, Wiese S, Rao S, Milenkovic D, Hutu DP, Zerbes RM, Schulze-Specking A, Meyer HE, Martinou JC, Rospert S, Rehling P, Meisinger C, Veenhuis M, Warscheid B, van der Klei IJ, Pfanner N, Chacinska A, van der Laan M", "evidence": [ { "database": "UniProtKB", "id": "Q96VH5", "url": "https://www.uniprot.org/uniprot/Q96VH5" } ], "reference": [ { "type": "PubMed", "id": "21944719", "url": "https://glygen.org/publication/PubMed/21944719" } ] }, { "title": "A mitochondrial-focused genetic interaction map reveals a scaffold-like complex required for inner membrane organization in mitochondria.", "journal": "J. Cell Biol.", "date": "2011", "authors": "Schuldiner M., Hoppins S., Nunnari J., Weissman J.S., Westermann B., Collins S.R., Hummel E., Cassidy-Stone A., Devay R.M., Lackner L.L.", "evidence": [ { "database": "UniProtKB", "id": "Q96VH5", "url": "https://www.uniprot.org/uniprot/Q96VH5" } ], "reference": [ { "type": "PubMed", "id": "21987634", "url": "https://glygen.org/publication/PubMed/21987634" } ] }, { "title": "The mitochondrial contact site complex, a determinant of mitochondrial architecture.", "journal": "EMBO J.", "date": "2011", "authors": "Mann M., Korner C., Walther D., Griffith J., Welsch U., Neupert W., Reggiori F., Mokranjac D., Harner M., Kaesmacher J.", "evidence": [ { "database": "UniProtKB", "id": "Q96VH5", "url": "https://www.uniprot.org/uniprot/Q96VH5" } ], "reference": [ { "type": "PubMed", "id": "22009199", "url": "https://glygen.org/publication/PubMed/22009199" } ] }, { "title": "MINOS1 is a conserved component of mitofilin complexes and required for mitochondrial function and cristae organization.", "journal": "Mol. Biol. Cell", "date": "2012", "authors": "Alkhaja AK, Jans DC, Nikolov M, Vukotic M, Lytovchenko O, Ludewig F, Schliebs W, Riedel D, Urlaub H, Jakobs S, Deckers M", "evidence": [ { "database": "UniProtKB", "id": "Q96VH5", "url": "https://www.uniprot.org/uniprot/Q96VH5" } ], "reference": [ { "type": "PubMed", "id": "22114354", "url": "https://glygen.org/publication/PubMed/22114354" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q96VH5", "url": "https://www.uniprot.org/uniprot/Q96VH5" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Uniform nomenclature for the mitochondrial contact site and cristae organizing system.", "journal": "J. Cell Biol.", "date": "2014", "authors": "Pfanner N, van der Laan M, Amati P, Capaldi RA, Caudy AA, Chacinska A, Darshi M, Deckers M, Hoppins S, Icho T, Jakobs S, Ji J, Kozjak-Pavlovic V, Meisinger C, Odgren PR, Park SK, Rehling P, Reichert AS, Sheikh MS, Taylor SS, Tsuchida N, van der Bliek AM, van der Klei IJ, Weissman JS, Westermann B, Zha J, Neupert W, Nunnari J", "evidence": [ { "database": "UniProtKB", "id": "Q96VH5", "url": "https://www.uniprot.org/uniprot/Q96VH5" } ], "reference": [ { "type": "PubMed", "id": "24687277", "url": "https://glygen.org/publication/PubMed/24687277" } ] } ], "pathway": [ { "id": "sce:YCL057C-A", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YCL057C-A", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q96VH5", "url": "https://www.uniprot.org/uniprot/Q96VH5" } ], "pmid": "" }, { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "Q96VH5", "url": "https://www.uniprot.org/uniprot/Q96VH5" } ], "pmid": "" }, { "name": "mitochondrial crista junction", "id": "GO:0044284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044284", "evidence": [ { "database": "UniProtKB", "id": "Q96VH5", "url": "https://www.uniprot.org/uniprot/Q96VH5" } ], "pmid": "" }, { "name": "MICOS complex", "id": "GO:0061617", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061617", "evidence": [ { "database": "UniProtKB", "id": "Q96VH5", "url": "https://www.uniprot.org/uniprot/Q96VH5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "membrane organization", "id": "GO:0061024", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061024", "evidence": [ { "database": "UniProtKB", "id": "Q96VH5", "url": "https://www.uniprot.org/uniprot/Q96VH5" } ], "pmid": "" }, { "name": "cristae formation", "id": "GO:0042407", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042407", "evidence": [ { "database": "UniProtKB", "id": "Q96VH5", "url": "https://www.uniprot.org/uniprot/Q96VH5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 22, "end_pos": 24, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }