{ "uniprot_canonical_ac": "Q967U1-1", "uniprot_ac": "Q967U1", "uniprot_id": "PSME_DICDI", "mass": { "chemical_mass": 26226.0, "monoisotopic_mass": 26226.0 }, "refseq": { "ac": "XP_639877", "name": "proteasome activator 28 subunit", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_639877" }, "gene_names": [ { "name": "psmE3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q967U1", "id": "Q967U1" }, { "name": "DDB_G0285099", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q967U1", "id": "Q967U1" }, { "name": "dpr1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q967U1", "id": "Q967U1" }, { "name": "psmE3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_639877", "id": "XP_639877" } ], "protein_names": [ { "name": "Proteasome activator 28", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q967U1" }, { "name": "PA28 homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q967U1" }, { "name": "proteasome activator 28 subunit", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_639877", "id": "XP_639877" }, { "name": "proteasome activator complex subunit 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_639877", "id": "XP_639877" } ], "function": [ { "annotation": "Subunit of the 11S REG (also called PA28) proteasome regulator, a doughnut-shaped homoheptamer which associates with the proteasome. 11S REG-gamma activates preferentially the trypsin-like catalytic subunit of the proteasome. May also be involved in cell cycle regulation.", "evidence": [ { "database": "UniProtKB", "id": "Q967U1", "url": "https://www.uniprot.org/uniprot/Q967U1#function" }, { "database": "PubMed", "id": "19411624", "url": "https://glygen.org/publication/PubMed/19411624" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "Q967U1", "url": "https://www.uniprot.org/uniprot/Q967U1" } ], "common_name": "Dictyostelium discoideum" } ], "gene": [ { "name": "psmE3", "url": "https://www.uniprot.org/uniprot/Q967U1", "locus": {} } ], "crossref": [ { "id": "DDB_G0285099", "url": "", "database": "", "categories": [ "Organism-specific" ] }, { "id": "8624948", "url": "https://www.ncbi.nlm.nih.gov/gene/8624948", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003186", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003186", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009077", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009077", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036252", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036252", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036997", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036997", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0285099", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0285099", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PMFNERN", "url": "https://omabrowser.org/oma/group/PMFNERN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR10660", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10660", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10660:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10660:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02252", "url": "http://pfam.xfam.org/family/PF02252", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q967U1", "url": "http://purl.obolibrary.org/obo/PR_Q967U1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DDI-1236978", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-1236978", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-174084", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-174084", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-174154", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-174154", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-174178", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-187577", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2467813", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-349425", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-349425", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5658442", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5687128", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5689603", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5689880", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-68949", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-68949", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-69017", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-69017", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-69601", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-69601", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-75815", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-75815", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-8854050", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-8854050", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-8948751", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-8951664", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9755511", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-983168", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_639877", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_639877", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q967U1", "url": "https://www.uniprot.org/uniprot/Q967U1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q967U1-1", "url": "https://www.uniprot.org/uniprot/Q967U1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSKNNSTVIKMDEQVLKYKEDLYEKTVHHLKVTIPKKIAEYQELAKSYGQNSENEQDGQTSKKRKLDSEDYVLMPIEDLIKTNRVIMETHQKFKKAYIELIETFSVIRGWISLNIPRIEDGNNFGVDVQEDIITQITKLEEVYTSLLDGSESYFASRASLVKKILKHKDIEAYRYSLAQVDEKEFTRFSFSYFDLANNYATTYSLIVKNFAKLETPRPTNASNIY", "length": 225, "header": "sp|Q967U1-1|PSME_DICDI Isoform 1 of Proteasome activator 28 OS=Dictyostelium discoideum OX=44689 GN=psmE3 PE=1 SV=1 CANONICAL=Q967U1-1" }, "isoforms": [ { "isoform_ac": "Q967U1-1", "url": "", "sequence": { "sequence": "MSKNNSTVIKMDEQVLKYKEDLYEKTVHHLKVTIPKKIAEYQELAKSYGQNSENEQDGQTSKKRKLDSEDYVLMPIEDLIKTNRVIMETHQKFKKAYIELIETFSVIRGWISLNIPRIEDGNNFGVDVQEDIITQITKLEEVYTSLLDGSESYFASRASLVKKILKHKDIEAYRYSLAQVDEKEFTRFSFSYFDLANNYATTYSLIVKNFAKLETPRPTNASNIY", "length": 225, "header": "sp|Q967U1-1|PSME_DICDI Isoform 1 of Proteasome activator 28 OS=Dictyostelium discoideum OX=44689 GN=psmE3 PE=1 SV=1 CANONICAL=Q967U1-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Chen G., Gibbs R.A., Gloeckner G., Hernandez J., Johnson D., Knights A., Lehmann R., Loulseged H., Ma J., Muzny D.M., Oliver K., Platzer M., Rosenthal A., Saito T., Sodergren E., Steffen D., Sugano S., Walker D., Weinstock G., Lu M., Muzny D., Tanaka Y., Song J., Sodergren E.J., Xu Q., Bankier A.T., Barrell B.G., Williams J., Fey P., Nie X., Gibbs R., Dear P.H., Szafranski K., Davies R., Price C., James K., Noegel A.A., Glockner G., Cooper J., Morio T., Davis P., Williams J.G., Kay R.R., Cronin A., Schleicher M., Olsen R., Kummerfeld S., Sharp S., Hauser H., Weinstock G.M., White B., Quiles M., Rost R., Tunggal B., Pain A., Madan Babu M., Madera M., Rivero F., Saunders D., Eichinger L., Sanders M., Kohara Y., Chisholm R.L., Barrell B., Churcher C.M., Hamlin N., Rajandream M.A., Thangavelu M., Quail M.A., Anjard C., Cox E.C., Haydock S., Kuspa A., Loomis W.F., Shaulsky G., Sucgang R., Urushihara H., Bason N., Berriman M., Buchrieser C., Churcher C., Desany B., Farbrother P., Felder M., Gaudet P., Goodhead I., Hall N., Harper D., Hemphill L., James K.D., Just E., Kerhornou A., Konfortov B.A., Lindsay R., Mourier T., Mungall K., Mungall K.L., Pachebat J.A., Pilcher K., Rabbinowitsch E., Simmonds M., Simmonds M.N., Spiegler S., Tivey A., Wardroper A., Winckler T., Woodward J., Woodward J.R., van Driessche N.", "evidence": [ { "database": "UniProtKB", "id": "Q967U1", "url": "https://www.uniprot.org/uniprot/Q967U1" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] }, { "title": "Characterization of a REG/PA28 proteasome activator homolog in Dictyostelium discoideum indicates that the ubiquitin- and ATP-independent REGgamma proteasome is an ancient nuclear protease.", "journal": "Eukaryot. Cell", "date": "2009", "authors": "Masson P., Young P., Lundin D., Soederbom F.", "evidence": [ { "database": "UniProtKB", "id": "Q967U1", "url": "https://www.uniprot.org/uniprot/Q967U1" } ], "reference": [ { "type": "PubMed", "id": "19411624", "url": "https://glygen.org/publication/PubMed/19411624" } ] } ], "pathway": [ { "id": "ddi:DDB_G0285099", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0285099", "resource": "KEGG Pathway" }, { "id": "R-DDI-1236978", "name": "Cross-presentation of soluble exogenous antigens (endosomes)", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-1236978", "resource": "Reactome", "description": "Cross-presentation of soluble exogenous antigens (endosomes)" }, { "id": "R-DDI-174084", "name": "Autodegradation of Cdh1 by Cdh1:APC/C", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-174084", "resource": "Reactome", "description": "Autodegradation of Cdh1 by Cdh1:APC/C" }, { "id": "R-DDI-174154", "name": "APC/C:Cdc20 mediated degradation of Securin", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-174154", "resource": "Reactome", "description": "APC/C:Cdc20 mediated degradation of Securin" }, { "id": "R-DDI-174178", "name": "APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-174178", "resource": "Reactome", "description": "APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1" }, { "id": "R-DDI-187577", "name": "SCF(Skp2)-mediated degradation of p27/p21", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-187577", "resource": "Reactome", "description": "SCF(Skp2)-mediated degradation of p27/p21" }, { "id": "R-DDI-2467813", "name": "Separation of Sister Chromatids", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2467813", "resource": "Reactome", "description": "Separation of Sister Chromatids" }, { "id": "R-DDI-349425", "name": "Autodegradation of the E3 ubiquitin ligase COP1", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-349425", "resource": "Reactome", "description": "Autodegradation of the E3 ubiquitin ligase COP1" }, { "id": "R-DDI-5658442", "name": "Regulation of RAS by GAPs", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5658442", "resource": "Reactome", "description": "Regulation of RAS by GAPs" }, { "id": "R-DDI-5687128", "name": "MAPK6/MAPK4 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5687128", "resource": "Reactome", "description": "MAPK6/MAPK4 signaling" }, { "id": "R-DDI-5689603", "name": "UCH proteinases", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5689603", "resource": "Reactome", "description": "UCH proteinases" }, { "id": "R-DDI-5689880", "name": "Ub-specific processing proteases", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5689880", "resource": "Reactome", "description": "Ub-specific processing proteases" }, { "id": "R-DDI-68949", "name": "Orc1 removal from chromatin", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-68949", "resource": "Reactome", "description": "Orc1 removal from chromatin" }, { "id": "R-DDI-69017", "name": "CDK-mediated phosphorylation and removal of Cdc6", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-69017", "resource": "Reactome", "description": "CDK-mediated phosphorylation and removal of Cdc6" }, { "id": "R-DDI-69601", "name": "Ubiquitin Mediated Degradation of Phosphorylated Cdc25A", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-69601", "resource": "Reactome", "description": "Ubiquitin Mediated Degradation of Phosphorylated Cdc25A" }, { "id": "R-DDI-75815", "name": "Ubiquitin-dependent degradation of Cyclin D", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-75815", "resource": "Reactome", "description": "Ubiquitin-dependent degradation of Cyclin D" }, { "id": "R-DDI-8854050", "name": "FBXL7 down-regulates AURKA during mitotic entry and in early mitosis", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-8854050", "resource": "Reactome", "description": "FBXL7 down-regulates AURKA during mitotic entry and in early mitosis" }, { "id": "R-DDI-8948751", "name": "Regulation of PTEN stability and activity", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-8948751", "resource": "Reactome", "description": "Regulation of PTEN stability and activity" }, { "id": "R-DDI-8951664", "name": "Neddylation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-8951664", "resource": "Reactome", "description": "Neddylation" }, { "id": "R-DDI-9755511", "name": "KEAP1-NFE2L2 pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9755511", "resource": "Reactome", "description": "KEAP1-NFE2L2 pathway" }, { "id": "R-DDI-983168", "name": "Antigen processing: Ubiquitination & Proteasome degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-983168", "resource": "Reactome", "description": "Antigen processing: Ubiquitination & Proteasome degradation" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q967U1", "url": "https://www.uniprot.org/uniprot/Q967U1" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q967U1", "url": "https://www.uniprot.org/uniprot/Q967U1" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q967U1", "url": "https://www.uniprot.org/uniprot/Q967U1" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "Q967U1", "url": "https://www.uniprot.org/uniprot/Q967U1" } ], "pmid": "" }, { "name": "proteasome activator complex", "id": "GO:0008537", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008537", "evidence": [ { "database": "UniProtKB", "id": "Q967U1", "url": "https://www.uniprot.org/uniprot/Q967U1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "positive regulation of endopeptidase activity", "id": "GO:0010950", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010950", "evidence": [ { "database": "UniProtKB", "id": "Q967U1", "url": "https://www.uniprot.org/uniprot/Q967U1" } ], "pmid": "" }, { "name": "protein catabolic process", "id": "GO:0030163", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030163", "evidence": [ { "database": "UniProtKB", "id": "Q967U1", "url": "https://www.uniprot.org/uniprot/Q967U1" } ], "pmid": "" }, { "name": "regulation of G1/S transition of mitotic cell cycle", "id": "GO:2000045", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000045", "evidence": [ { "database": "UniProtKB", "id": "Q967U1", "url": "https://www.uniprot.org/uniprot/Q967U1" } ], "pmid": "" }, { "name": "regulation of proteasomal protein catabolic process", "id": "GO:0061136", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061136", "evidence": [ { "database": "UniProtKB", "id": "Q967U1", "url": "https://www.uniprot.org/uniprot/Q967U1" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "endopeptidase activator activity", "id": "GO:0061133", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061133", "evidence": [ { "database": "UniProtKB", "id": "Q967U1", "url": "https://www.uniprot.org/uniprot/Q967U1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 220, "end_pos": 222, "annotation": "n_glycosylation_sequon" }, { "start_pos": 4, "end_pos": 6, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }