{ "uniprot_canonical_ac": "Q94981-1", "uniprot_ac": "Q94981", "uniprot_id": "ARI1_DROME", "mass": { "chemical_mass": 58932.0, "monoisotopic_mass": 58932.0 }, "refseq": { "ac": "NP_001245736", "name": "ariadne 1, isoform D", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001245736" }, "gene_names": [ { "name": "ari-1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q94981", "id": "Q94981" }, { "name": "AAS65398.1; ari; Ari-1; ari-1a; ARI1_DROME; CG5659; Dmel\\CG5659; HL-V; l(1)16Fj", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001245736", "id": "NP_001245736" }, { "name": "AAS65398.1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94981", "id": "Q94981" }, { "name": "ARI1_DROME", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94981", "id": "Q94981" }, { "name": "Ari-1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94981", "id": "Q94981" }, { "name": "CG5659", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94981", "id": "Q94981" }, { "name": "Dmel\\CG5659", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94981", "id": "Q94981" }, { "name": "Dmel_CG5659", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94981", "id": "Q94981" }, { "name": "HL-V", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94981", "id": "Q94981" }, { "name": "ari-1a", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94981", "id": "Q94981" }, { "name": "ari-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001245736", "id": "NP_001245736" }, { "name": "ari", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94981", "id": "Q94981" }, { "name": "l(1)16Fj", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94981", "id": "Q94981" } ], "protein_names": [ { "name": "E3 ubiquitin-protein ligase ariadne-1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q94981" }, { "name": "2.3.2.31", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q94981" }, { "name": "CG5659-PD; ari-1-PD; ariadne; Ariadne-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001245736", "id": "NP_001245736" }, { "name": "Protein ariadne-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q94981" }, { "name": "RING-type E3 ubiquitin transferase ariadne-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q94981" }, { "name": "ariadne 1, isoform D", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001245736", "id": "NP_001245736" } ], "function": [ { "annotation": "Atypical E3 ubiquitin-protein ligase, which catalyzes ubiquitination of target proteins together with ubiquitin-conjugating enzyme E2 Ubc10 (PubMed:10880484, PubMed:21900267, PubMed:29689197). Controls the subcellular localization and morphology of muscle nuclei (myonuclei) by regulating the protein levels and distribution of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex (PubMed:29689197). Functions by mediating the monoubiquitination of the LINC complex subunit koi leading to its subsequent proteasomal degradation (PubMed:29689197). Appears to function, at least partially redundantly, with the RBR E3 ligase family member park in nuclear localization and morphology (PubMed:29689197). Likely to function in metamorphosis by regulating the proteins levels of EcR isoform A (ECR-A) and its heterodimeric partner usp, via the ubiquitination and subsequent degradation of ECR-A (PubMed:21900267).", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981#function" }, { "database": "PubMed", "id": "29689197", "url": "https://glygen.org/publication/PubMed/29689197" }, { "database": "PubMed", "id": "10880484", "url": "https://glygen.org/publication/PubMed/10880484" }, { "database": "PubMed", "id": "21900267", "url": "https://glygen.org/publication/PubMed/21900267" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 136, "end_pos": 136, "sequence_org": "C", "sequence_mut": "Y", "comment": "In ari-1a; Loss of catalytic activity. Late pupal lethal and adult escapers have a reduced lifespan and thinner bristles. Nuclei in larval muscles (myonuclei) are displaced from the cell membrane, exhibit clustering and morphological defects, likely due to the mislocalization of the LINC complex. Reduced degradation of the LINC complex member koi.", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" }, { "database": "PubMed", "id": "29689197", "url": "https://glygen.org/publication/PubMed/29689197" } ] }, { "start_pos": 150, "end_pos": 150, "sequence_org": "C", "sequence_mut": "Y", "comment": "In ari1-2; lethal phenotype and loss of interaction with Ubc10.", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" }, { "database": "PubMed", "id": "10880484", "url": "https://glygen.org/publication/PubMed/10880484" } ] }, { "start_pos": 187, "end_pos": 187, "sequence_org": "V", "sequence_mut": "E", "comment": "In ari-1b; Loss of catalytic activity. Late pupal lethal and adult escapers have a reduced lifespan and thinner bristles. Nuclei in larval muscles (myonuclei) are displaced from the cell membrane, exhibit clustering and morphological defects, likely due to the mislocalization of the LINC complex; when associated with P-332.", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" }, { "database": "PubMed", "id": "29689197", "url": "https://glygen.org/publication/PubMed/29689197" } ] }, { "start_pos": 223, "end_pos": 223, "sequence_org": "C", "sequence_mut": "S", "comment": "In ari-1d; late pupal lethal and adult escapers have a reduced lifespan and thinner bristles. Nuclei in larval muscles (myonuclei) are displaced from the cell membrane, exhibit clustering and morphological defects.", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" }, { "database": "PubMed", "id": "29689197", "url": "https://glygen.org/publication/PubMed/29689197" } ] }, { "start_pos": 304, "end_pos": 304, "sequence_org": "C", "sequence_mut": "S", "comment": "Loss of catalytic activity and impaired autoinhibition; when associated with A-377; A-378 and A-450.", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" }, { "database": "PubMed", "id": "29689197", "url": "https://glygen.org/publication/PubMed/29689197" } ] }, { "start_pos": 309, "end_pos": 309, "sequence_org": "C", "sequence_mut": "Y", "comment": "In ari1-3; lethal phenotype and no loss of interaction with Ubc10.", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" }, { "database": "PubMed", "id": "10880484", "url": "https://glygen.org/publication/PubMed/10880484" } ] }, { "start_pos": 332, "end_pos": 332, "sequence_org": "S", "sequence_mut": "P", "comment": "In ari-1b; Loss of catalytic activity. Late pupal lethal and adult escapers have a reduced lifespan and thinner bristles. Nuclei in larval muscles (myonuclei) are displaced from the cell membrane, exhibit clustering and morphological defects, likely due to the mislocalization of the LINC complex; when associated with E-187.", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" }, { "database": "PubMed", "id": "29689197", "url": "https://glygen.org/publication/PubMed/29689197" } ] }, { "start_pos": 377, "end_pos": 377, "sequence_org": "F", "sequence_mut": "A", "comment": "Impairs autoinhibition; when associated with A-378 and A-450. Loss of activity and impaired autoinhibition; when associated with A-378; A-450 and S-304.", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" }, { "database": "PubMed", "id": "29689197", "url": "https://glygen.org/publication/PubMed/29689197" } ] }, { "start_pos": 378, "end_pos": 378, "sequence_org": "E", "sequence_mut": "A", "comment": "Impairs autoinhibition; when associated with A-377 and A-450. Loss of activity and impaired autoinhibition; when associated with A-377; A-450 and S-304.", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" }, { "database": "PubMed", "id": "29689197", "url": "https://glygen.org/publication/PubMed/29689197" } ] }, { "start_pos": 450, "end_pos": 450, "sequence_org": "E", "sequence_mut": "A", "comment": "Impairs autoinhibition; when associated with A-377 and A-378. Loss of activity and impaired autoinhibition; when associated with A-377; A-378 and S-304.", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" }, { "database": "PubMed", "id": "29689197", "url": "https://glygen.org/publication/PubMed/29689197" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "ari-1", "url": "https://www.uniprot.org/uniprot/Q94981", "locus": { "chromosome": "X", "start_pos": 18130392, "end_pos": 18137784, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0017418", "url": "https://www.ensembl.org/id/FBgn0017418" } ] } } ], "crossref": [ { "id": "FBgn0017418", "url": "https://bgee.org/?page=gene&gene_id=FBgn0017418", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd16626", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16626", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd20343", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20343", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd20356", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20356", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0017418", "url": "https://flybase.org/reports/FBgn0017418", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "32796", "url": "https://www.ncbi.nlm.nih.gov/gene/32796", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q94981", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q94981*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001841", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001841", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002867", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002867", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018957", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018957", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR031127", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031127", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044066", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044066", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045840", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045840", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG5659", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG5659", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "SSGMSWI", "url": "https://omabrowser.org/oma/group/SSGMSWI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3084186at2759", "url": "http://www.orthodb.org/?query=3084186at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11685", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11685", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11685:SF212", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11685:SF212", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00097", "url": "http://pfam.xfam.org/family/PF00097", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01485", "url": "http://pfam.xfam.org/family/PF01485", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF19422", "url": "http://pfam.xfam.org/family/PF19422", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q94981", "url": "http://purl.obolibrary.org/obo/PR_Q94981", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DME-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-1169408", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001245736", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001245736", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A4V4Q7", "url": "https://www.uniprot.org/uniprot/A4V4Q7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A4V4Q7-1", "url": "https://www.uniprot.org/uniprot/A4V4Q7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q94981-1", "url": "https://www.uniprot.org/uniprot/Q94981-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDSDNDNDFCDNVDSGNVSSGDDGDDDFGMEVDLPSSADRQMDQDDYQYKVLTTDEIVQHQREIIDEANLLLKLPTPTTRILLNHFKWDKEKLLEKYFDDNTDEFFKCAHVINPFNATEAIKQKTSRSQCEECEICFSQLPPDSMAGLECGHRFCMPCWHEYLSTKIVAEGLGQTISCAAHGCDILVDDVTVANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYAEPRRVHCKCGHVFCFACGENWHDPVKCRWLKKWIKKCDDDSETSNWIAANTKECPRCSVTIEKDGGCNHMVCKNQNCKNEFCWVCLGSWEPHGSSWYNCNRYDEDEAKTARDAQEKLRSSLARYLHYYNRYMNHMQSMKFENKLYASVKQKMEEMQQHNMSWIEVQFLKKAVDILCQCRQTLMYTYVFAYYLKKNNQSMIFEDNQKDLESATEMLSEYLERDITSENLADIKQKVQDKYRYCEKRCSVLLKHVHEGYDKEWWEYTE", "length": 503, "header": "sp|Q94981-1|ARI1_DROME Isoform 1 of E3 ubiquitin-protein ligase ariadne-1 OS=Drosophila melanogaster OX=7227 GN=ari-1 PE=1 SV=2 CANONICAL=Q94981-1" }, "isoforms": [ { "isoform_ac": "A4V4Q7-1", "url": "", "sequence": { "sequence": "MDSDNDNDFCDNVDSGNVSSGDDGDDDFGMEVDLPSSADRQMDQDDYQYKVLTTDEIVQHQREIIDEANLLLKLPTPTTRILLNHFKWDKEKLLEKYFDDNTDEFFKCAHVINPFNATEAIKQKTSRSQCEECEICFSQLPPDSMAGLECGHRFCMPCWHEYLSTKIVAEGLGQTISCAAHGCDILVDDVTVANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYAEPRRVHCKCGHVFCFACGENWHDPVKCRWLKKWIKKCDDDSETSNWIAANTKECPRCSVTIEKDGGCNHMVCKNQNCKNEFCWVCLGSWEPHGSSWYNCNRYDEDEAKTARDAQEKLRSSLARYLHYYNRYMNHMQSMKFENKLYASVKQKMEEMQQHNMSWIEVQFLKKAVDILCQCRQTLMYTYVFAYYLKKNNQSMIFEDNQKDLESATEMLSEYLERDITSENLADIKQKVQDKYRYCEKRCSVLLKHVHEGYDKEWWEYTE", "length": 503, "header": "tr|A4V4Q7-1|ARI1_DROME Computationally mapped isoform of E3 ubiquitin-protein ligase ariadne-1 OS=Drosophila melanogaster OX=7227 GN=ari-1 PE=1 SV=1 CANONICAL=Q94981-1" }, "locus": { "chromosome": "X", "start_pos": 18136660, "end_pos": 18132799, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0332851", "url": "https://www.ensembl.org/id/FBtr0332851" }, { "database": "Ensembl Peptide", "id": "FBpp0305074", "url": "https://www.ensembl.org/id/FBpp0305074" } ] } }, { "isoform_ac": "Q94981-1", "url": "", "sequence": { "sequence": "MDSDNDNDFCDNVDSGNVSSGDDGDDDFGMEVDLPSSADRQMDQDDYQYKVLTTDEIVQHQREIIDEANLLLKLPTPTTRILLNHFKWDKEKLLEKYFDDNTDEFFKCAHVINPFNATEAIKQKTSRSQCEECEICFSQLPPDSMAGLECGHRFCMPCWHEYLSTKIVAEGLGQTISCAAHGCDILVDDVTVANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYAEPRRVHCKCGHVFCFACGENWHDPVKCRWLKKWIKKCDDDSETSNWIAANTKECPRCSVTIEKDGGCNHMVCKNQNCKNEFCWVCLGSWEPHGSSWYNCNRYDEDEAKTARDAQEKLRSSLARYLHYYNRYMNHMQSMKFENKLYASVKQKMEEMQQHNMSWIEVQFLKKAVDILCQCRQTLMYTYVFAYYLKKNNQSMIFEDNQKDLESATEMLSEYLERDITSENLADIKQKVQDKYRYCEKRCSVLLKHVHEGYDKEWWEYTE", "length": 503, "header": "sp|Q94981-1|ARI1_DROME Isoform 1 of E3 ubiquitin-protein ligase ariadne-1 OS=Drosophila melanogaster OX=7227 GN=ari-1 PE=1 SV=2 CANONICAL=Q94981-1" }, "locus": { "chromosome": "X", "start_pos": 18136660, "end_pos": 18132799, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0332851", "url": "https://www.ensembl.org/id/FBtr0332851" }, { "database": "Ensembl Peptide", "id": "FBpp0305074", "url": "https://www.ensembl.org/id/FBpp0305074" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "A4V4Q7", "url": "https://www.uniprot.org/uniprot/A4V4Q7" }, { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Ariadne-1: a vital Drosophila gene is required in development and defines a new conserved family of ring-finger proteins.", "journal": "Genetics", "date": "2000", "authors": "Aguilera M, Oliveros M, Martinez-Padron M, Barbas JA, Ferrus A", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "reference": [ { "type": "PubMed", "id": "10880484", "url": "https://glygen.org/publication/PubMed/10880484" } ] }, { "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.", "journal": "Genome Biol.", "date": "2002", "authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM", "evidence": [ { "database": "UniProtKB", "id": "A4V4Q7", "url": "https://www.uniprot.org/uniprot/A4V4Q7" } ], "reference": [ { "type": "PubMed", "id": "12537568", "url": "https://glygen.org/publication/PubMed/12537568" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "A4V4Q7", "url": "https://www.uniprot.org/uniprot/A4V4Q7" }, { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.", "journal": "Genome Biol.", "date": "2002", "authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "A4V4Q7", "url": "https://www.uniprot.org/uniprot/A4V4Q7" } ], "reference": [ { "type": "PubMed", "id": "12537573", "url": "https://glygen.org/publication/PubMed/12537573" } ] }, { "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.", "journal": "Genome Biol.", "date": "2002", "authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "A4V4Q7", "url": "https://www.uniprot.org/uniprot/A4V4Q7" } ], "reference": [ { "type": "PubMed", "id": "12537574", "url": "https://glygen.org/publication/PubMed/12537574" } ] }, { "title": "Combined evidence annotation of transposable elements in genome sequences.", "journal": "PLoS Comput. Biol.", "date": "2005", "authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D", "evidence": [ { "database": "UniProtKB", "id": "A4V4Q7", "url": "https://www.uniprot.org/uniprot/A4V4Q7" } ], "reference": [ { "type": "PubMed", "id": "16110336", "url": "https://glygen.org/publication/PubMed/16110336" } ] }, { "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Smith CD, Shu S, Mungall CJ, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "A4V4Q7", "url": "https://www.uniprot.org/uniprot/A4V4Q7" } ], "reference": [ { "type": "PubMed", "id": "17569856", "url": "https://glygen.org/publication/PubMed/17569856" } ] }, { "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "A4V4Q7", "url": "https://www.uniprot.org/uniprot/A4V4Q7" } ], "reference": [ { "type": "PubMed", "id": "17569867", "url": "https://glygen.org/publication/PubMed/17569867" } ] }, { "title": "Isoform-specific regulation of a steroid hormone nuclear receptor by an E3 ubiquitin ligase in Drosophila melanogaster.", "journal": "Genetics", "date": "2011", "authors": "Ferrus A., Mansilla A., Gradilla A.C.", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "reference": [ { "type": "PubMed", "id": "21900267", "url": "https://glygen.org/publication/PubMed/21900267" } ] }, { "title": "The Release 6 reference sequence of the Drosophila melanogaster genome.", "journal": "Genome Res.", "date": "2015", "authors": "Hoskins RA, Carlson JW, Wan KH, Park S, Mendez I, Galle SE, Booth BW, Pfeiffer BD, George RA, Svirskas R, Krzywinski M, Schein J, Accardo MC, Damia E, Messina G, Mendez-Lago M, de Pablos B, Demakova OV, Andreyeva EN, Boldyreva LV, Marra M, Carvalho AB, Dimitri P, Villasante A, Zhimulev IF, Rubin GM, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "A4V4Q7", "url": "https://www.uniprot.org/uniprot/A4V4Q7" } ], "reference": [ { "type": "PubMed", "id": "25589440", "url": "https://glygen.org/publication/PubMed/25589440" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: The Rule-Benders.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Crosby MA, Gramates LS, Dos Santos G, Matthews BB, St Pierre SE, Zhou P, Schroeder AJ, Falls K, Emmert DB, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "A4V4Q7", "url": "https://www.uniprot.org/uniprot/A4V4Q7" } ], "reference": [ { "type": "PubMed", "id": "26109356", "url": "https://glygen.org/publication/PubMed/26109356" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Matthews BB, Dos Santos G, Crosby MA, Emmert DB, St Pierre SE, Gramates LS, Zhou P, Schroeder AJ, Falls K, Strelets V, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "A4V4Q7", "url": "https://www.uniprot.org/uniprot/A4V4Q7" } ], "reference": [ { "type": "PubMed", "id": "26109357", "url": "https://glygen.org/publication/PubMed/26109357" } ] }, { "title": "Ari-1 Regulates Myonuclear Organization Together with Parkin and Is Associated with Aortic Aneurysms.", "journal": "Dev. Cell", "date": "2018", "authors": "Tan KL, Haelterman NA, Kwartler CS, Regalado ES, Lee PT, Nagarkar-Jaiswal S, Guo DC, Duraine L, Wangler MF, Bamshad MJ, Nickerson DA, Lin G, Milewicz DM, Bellen HJ", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "reference": [ { "type": "PubMed", "id": "29689197", "url": "https://glygen.org/publication/PubMed/29689197" } ] } ], "pathway": [ { "id": "dme:Dmel_CG5659", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG5659", "resource": "KEGG Pathway" }, { "id": "R-DME-1169408", "name": "ISG15 antiviral mechanism", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-1169408", "resource": "Reactome", "description": "ISG15 antiviral mechanism" } ], "orthologs": [ { "uniprot_canonical_ac": "P36113-1", "protein_name": "E3 ubiquitin-protein ligase HEL1", "gene_name": "HEL1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MSSGTENDQFYSFDESDSSSIELYESHNTSEFTIHGLVFPKLISVTSQDSEFDINEDEDGVDTIYEGMLDAPLTKNNKRILCEGSVPNLSYECLTTKGIFERMLQRVDHLQPIFAIPSADILILLQHYDWNEERLLEVWTEKMDELLVELGLSTTANIKKDNDYNSHFREVEFKNDFTCIICCDKKDTETFALECGHEYCINCYRHYIKDKLHEGNIITCMDCSLALKNEDIDKVMGHPSSSKLMDSSIKSFVQKHNRNYKWCPFADCKSIVHLRDTSSLPEYTRLHYSPFVKCNSFHRFCFNCGFEVHSPADCKITTAWVKKARKESEILNWVLSHTKECPKCSVNIEKNGGCNHMVCSSCKYEFCWICEGPWAPHGKNFFQCTMYKNNEDNKSKNPQDANKTLKKYTFYYRLFNEHEVSAKLDWNLGQTLGTKVHALQERIGISWIDGQFLSESLKVLNEGRTVLKWSFAVAYYSDASHNLTKIFVDNQMLLANAVESLSELLQIKTPEVIMKRRPEFYNKAGYVENRTTALMECGRELLCKGICKAAE", "length": 551 }, "evidence": [ { "id": "Q94981", "url": "https://omabrowser.org/oma/group/Q94981/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q9Y4X5-1", "protein_name": "E3 ubiquitin-protein ligase ARIH1", "gene_name": "ARIH1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDSDEGYNYEFDEDEECSEEDSGAEEEEDEDDDEPDDDTLDLGEVELVEPGLGVGGERDGLLCGETGGGGGSALGPGGGGGGGGGGGGGGPGHEQEEDYRYEVLTAEQILQHMVECIREVNEVIQNPATITRILLSHFNWDKEKLMERYFDGNLEKLFAECHVINPSKKSRTRQMNTRSSAQDMPCQICYLNYPNSYFTGLECGHKFCMQCWSEYLTTKIMEEGMGQTISCPAHGCDILVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAKPVRCKCGRQFCFNCGENWHDPVKCKWLKKWIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYCNRYMNHMQSLRFEHKLYAQVKQKMEEMQQHNMSWIEVQFLKKAVDVLCQCRATLMYTYVFAFYLKKNNQSIIFENNQADLENATEVLSGYLERDISQDSLQDIKQKVQDKYRYCESRRRVLLQHVHEGYEKDLWEYIED", "length": 557 }, "evidence": [ { "id": "Q94981", "url": "https://omabrowser.org/oma/group/Q94981/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9Z1K5-1", "protein_name": "E3 ubiquitin-protein ligase ARIH1", "gene_name": "Arih1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDSDEGYNYEFDEDEECSEEDSGAEEEEDDDEDEPDDDNLDLGEVELVEPGLGVGGERDGLLCGETGGGGGSALGPGGGGGGGGGGGGPGHEQEEDYRYEVLTAEQILQHMVECIREVNEVIQNPATITRILLSHFNWDKEKLMERYFDGNLEKLFAECHVINPSKKSRTRQMNTRSSAQDMPCQICYLNYPNSYFTGLECGHKFCMQCWSEYLTTKIMEEGMGQTISCPAHGCDILVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAKPVRCKCGRQFCFNCGENWHDPVKCKWLKKWIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYCNRYMNHMQSLRFEHKLYAQVKQKMEEMQQHNMSWIEVQFLKKAVDVLCQCRATLMYTYVFAFYLKKNNQSIIFENNQADLENATEVLSGYLERDISQDSLQDIKQKVQDKYRYCESRRRVLLQHVHEGYEKDLWEYIED", "length": 555 }, "evidence": [ { "id": "Q94981", "url": "https://omabrowser.org/oma/group/Q94981/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "pmid": "" }, { "name": "ubiquitin-protein transferase activity", "id": "GO:0004842", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004842", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "pmid": "" }, { "name": "ubiquitin protein ligase activity", "id": "GO:0061630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061630", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "pmid": "" }, { "name": "ubiquitin conjugating enzyme binding", "id": "GO:0031624", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031624", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "protein ubiquitination", "id": "GO:0016567", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "pmid": "" }, { "name": "positive regulation of proteasomal ubiquitin-dependent protein catabolic process", "id": "GO:0032436", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032436", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "pmid": "" }, { "name": "ubiquitin-dependent protein catabolic process", "id": "GO:0006511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006511", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "pmid": "" }, { "name": "oogenesis", "id": "GO:0048477", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048477", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "pmid": "" }, { "name": "endoplasmic reticulum organization", "id": "GO:0007029", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007029", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "pmid": "" }, { "name": "positive regulation of neurogenesis", "id": "GO:0050769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050769", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "pmid": "" }, { "name": "protein monoubiquitination", "id": "GO:0006513", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006513", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "pmid": "" }, { "name": "positive regulation of proteasomal protein catabolic process", "id": "GO:1901800", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901800", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "pmid": "" }, { "name": "ubiquitin ligase complex", "id": "GO:0000151", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000151", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 116, "end_pos": 118, "annotation": "n_glycosylation_sequon" }, { "start_pos": 17, "end_pos": 19, "annotation": "n_glycosylation_sequon" }, { "start_pos": 396, "end_pos": 398, "annotation": "n_glycosylation_sequon" }, { "start_pos": 433, "end_pos": 435, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Autophosphorylated.", "evidence": [ { "database": "UniProtKB", "id": "Q94981", "url": "https://www.uniprot.org/uniprot/Q94981" }, { "database": "PubMed", "id": "29689197", "url": "https://glygen.org/publication/PubMed/29689197" } ] } ], "interactions": [], "reactions": [ { "id": "R-DME-1678842", "name": "Competitive inhibition of translation initiation by ISGylated 4EHP", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q02748-1", "Q94981-1", "Q9VHS8-1", "P52487-1", "Q7K738-1" ], "evidence": [ { "id": "R-DME-1678842", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-1678842" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P52487", "gene_name": "Ubc84D", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P52487", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52487" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P52487", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52487" } ] } ] }, { "uniprot_ac": "Q02748", "gene_name": "eIF4A", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q02748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02748" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "Q02748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02748" } ] } ] }, { "uniprot_ac": "Q7K738", "gene_name": "Ubc10", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q7K738", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K738" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q7K738", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K738" } ] } ] }, { "uniprot_ac": "Q94981", "gene_name": "ari-1", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "Q94981", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q94981" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "Q94981", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q94981" } ] } ] }, { "uniprot_ac": "Q9VHS8", "gene_name": "", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q9VHS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHS8" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "Q9VHS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHS8" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }