{ "uniprot_canonical_ac": "Q94514-1", "uniprot_ac": "Q94514", "uniprot_id": "COX5A_DROME", "mass": { "chemical_mass": 16622.0, "monoisotopic_mass": 16622.0 }, "refseq": { "ac": "NP_001262488", "name": "cytochrome c oxidase subunit 5A, isoform C", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262488" }, "gene_names": [ { "name": "COX5A", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q94514", "id": "Q94514" }, { "name": "CG14724; cova; CoVa; COX; COX-5A; cox5A; Cox5a; COX5a; COXA; COXA_DROME; Dmel\\CG14724; Q94514; tend; Va", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262488", "id": "NP_001262488" }, { "name": "CG14724", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94514", "id": "Q94514" }, { "name": "COX5A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262488", "id": "NP_001262488" }, { "name": "COXA_DROME", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94514", "id": "Q94514" }, { "name": "COXA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94514", "id": "Q94514" }, { "name": "COX", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94514", "id": "Q94514" }, { "name": "CoVa", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94514", "id": "Q94514" }, { "name": "Cox5a", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94514", "id": "Q94514" }, { "name": "Dmel\\CG14724", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94514", "id": "Q94514" }, { "name": "Dmel_CG14724", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94514", "id": "Q94514" }, { "name": "Va", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94514", "id": "Q94514" }, { "name": "cova", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94514", "id": "Q94514" }, { "name": "tend", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q94514", "id": "Q94514" } ], "protein_names": [ { "name": "Cytochrome c oxidase subunit 5A, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q94514" }, { "name": "CG14724-PC; COX5A-PC; cytochrome c oxidase subunit Va preprotein; subunit Va of complex IV; cytochrome oxidase subunit Va; cytochrome c oxidase polypeptide Va; cytochrome oxidase Va; subunit 5A; cytochrome c oxidase Va, mt precursor; cytochrome-c oxidase subunit Va; tenured", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262488", "id": "NP_001262488" }, { "name": "Cytochrome c oxidase polypeptide Va", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q94514" }, { "name": "cytochrome c oxidase subunit 5A, isoform C", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262488", "id": "NP_001262488" } ], "function": [ { "annotation": "Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.", "evidence": [ { "database": "UniProtKB", "id": "Q94514", "url": "https://www.uniprot.org/uniprot/Q94514#function" }, { "database": "UniProtKB", "id": "P00427", "url": "https://www.uniprot.org/uniprot/P00427#function" }, { "database": "UniProtKB", "id": "A0A0B4KFT0", "url": "https://www.uniprot.org/uniprot/A0A0B4KFT0#function" }, { "database": "UniProtKB", "id": "RU368103", "url": "https://www.uniprot.org/uniprot/RU368103#function" } ] } ], "disease": [ { "disease_id": "DOID:0050545", "recommended_name": { "id": "DOID:0050545", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050545", "name": "visceral heterotaxy", "description": "A physical disorder characterized by the abnormal distribution of the major visceral organs within the chest and abdomen." }, "synonyms": [ { "id": "DOID:0050545", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050545", "name": "heterotaxia", "description": "" }, { "id": "DOID:0050545", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050545", "name": "situs ambiguus", "description": "" }, { "id": "MONDO:0011546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011546", "name": "heterotaxy, visceral, 2, autosomal", "description": "" }, { "id": "MONDO:0011546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011546", "name": "DTGA2", "description": "" }, { "id": "MONDO:0011546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011546", "name": "heterotaxy, visceral, 2, autosomal", "description": "" }, { "id": "MONDO:0011546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011546", "name": "transposition of the great arteries, dextro-looped 2", "description": "" }, { "id": "MONDO:0011546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011546", "name": "HTX2", "description": "" }, { "id": "MONDO:0011546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011546", "name": "Htx", "description": "" }, { "id": "MONDO:0011659", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011659", "name": "heterotaxy, visceral, 3, autosomal", "description": "" }, { "id": "MONDO:0011659", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011659", "name": "HTX3", "description": "" }, { "id": "MONDO:0011659", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011659", "name": "heterotaxy, visceral, 3, autosomal", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "heterotaxy, visceral, 1, X-linked", "description": "X-linked visceral heterotaxy type 1 is a very rare form of heterotaxy that has only been reported in a few families. Heterotaxy is the right/left transposition of thoracic and/or abdominal organs. This condition is caused by mutations in the ZIC3 gene, is inherited in an X-linked recessive fashion, and is usually seen in males. Physical features include heart abnormalities such as dextrocardia, transposition of great vessels, ventricular septal defect, patent ductus arteriosus, pulmonic stenosis ; situs inversus, and missing (asplenia) and/or extra spleens (polysplenia).Affected individualscan also experience abnormalities in the development of the midline of the body, which can cause holoprosencephaly, myelomeningocele, urological anomalies, widely spaced eyes (hypertelorism), cleft palate, and abnormalities of the sacral spine and anus. Heterotaxia with recurrent respiratory infections are called primary ciliary dyskinesia." }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "ZIC3 visceral heterotaxy", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "congenital heart defects, nonsyndromic, 1, X-linked, X-linked recessive", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "heterotaxy, visceral, 1, X-linked", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "heterotaxy, visceral, 1, X-linked, X-linked recessive", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "visceral heterotaxy caused by mutation in ZIC3", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "HTX1", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "X-linked visceral heterotaxy 1", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "congenital heart defects, multiple types, 1, X-linked", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "dextrocardia with Other Cardiac malformations", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "heterotaxy, visceral, X-linked", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "laterality, X-linked", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "situs inversus, Complex Cardiac defects, and splenic defects, X-linked", "description": "" }, { "id": "MONDO:0013887", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013887", "name": "heterotaxy, visceral, 6, autosomal", "description": "" }, { "id": "MONDO:0013887", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013887", "name": "heterotaxy, visceral, 6, autosomal", "description": "" }, { "id": "MONDO:0013887", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013887", "name": "heterotaxy, visceral, 6, autosomal recessive", "description": "" }, { "id": "MONDO:0013887", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013887", "name": "HTX6", "description": "" }, { "id": "MONDO:0013403", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013403", "name": "heterotaxy, visceral, 4, autosomal", "description": "Any visceral heterotaxy in which the cause of the disease is a mutation in the ACVR2B gene." }, { "id": "MONDO:0013403", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013403", "name": "ACVR2B visceral heterotaxy", "description": "" }, { "id": "MONDO:0013403", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013403", "name": "heterotaxy, visceral, 4, autosomal", "description": "" }, { "id": "MONDO:0013403", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013403", "name": "visceral heterotaxy caused by mutation in ACVR2B", "description": "" }, { "id": "MONDO:0013403", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013403", "name": "HTX4", "description": "" }, { "id": "MIM:605376", "resource": "MIM", "url": "https://www.omim.org/entry/605376", "name": "Heterotaxy, visceral, 2, autosomal", "description": "Heterotaxy, visceral, 2, autosomal" }, { "id": "MIM:306955", "resource": "MIM", "url": "https://www.omim.org/entry/306955", "name": "Heterotaxy, visceral, 1, X-linked", "description": "Heterotaxy, visceral, 1, X-linked" }, { "id": "MIM:614779", "resource": "MIM", "url": "https://www.omim.org/entry/614779", "name": "Heterotaxy, visceral, 6, autosomal", "description": "Heterotaxy, visceral, 6, autosomal" }, { "id": "MIM:613751", "resource": "MIM", "url": "https://www.omim.org/entry/613751", "name": "Heterotaxy, visceral, 4, autosomal", "description": "Heterotaxy, visceral, 4, autosomal" } ], "evidence": [ { "id": "0050545", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050545" } ] }, { "disease_id": "DOID:0060340", "recommended_name": { "id": "DOID:0060340", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060340", "name": "ciliopathy", "description": "A syndrome associated with mutations encoding defective proteins, which result in either abnormal function formation or function of cilia." }, "synonyms": [], "evidence": [ { "id": "0060340", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060340" } ] }, { "disease_id": "DOID:3762", "recommended_name": { "id": "DOID:3762", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3762", "name": "cytochrome-c oxidase deficiency disease", "description": "A mitochondrial metabolism disease that is characterized by deficiency of cytochrome c oxidase, myopathy, hepatomegaly, hypertrophic cardiomyopathy, lactic acidosis, and Leigh syndrome, and is caused by mutations related to oxidative phosphorylation." }, "synonyms": [ { "id": "DOID:3762", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3762", "name": "MITOCHONDRIAL COMPLEX IV DEFICIENCY", "description": "" }, { "id": "MONDO:0009068", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009068", "name": "cytochrome-c oxidase deficiency disease", "description": "A very rare inherited metabolic disorder characterized by deficiency of the enzyme cytochrome-C oxidase. It may be manifested as an isolated myopathy or a systemic disorder. Signs and symptoms include myotonia, dysfunction of the heart, kidney, and brain, and lactic acidosis." }, { "id": "MONDO:0009068", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009068", "name": "cytochrome-C oxidase deficiency", "description": "" }, { "id": "MONDO:0009068", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009068", "name": "cytochrome-c oxidase deficiency disease", "description": "" }, { "id": "MONDO:0009068", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009068", "name": "isolated COX deficiency", "description": "" }, { "id": "MONDO:0009068", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009068", "name": "isolated mitochondrial respiratory chain complex IV deficiency", "description": "" }, { "id": "MONDO:0009068", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009068", "name": "mitochondrial complex IV deficiency", "description": "" }, { "id": "MONDO:0009068", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009068", "name": "mitochondrial complex IV deficiency, nuclear type 1", "description": "" }, { "id": "MONDO:0009068", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009068", "name": "COX deficiency", "description": "" }, { "id": "MONDO:0009068", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009068", "name": "Complex 4 mitochondrial respiratory chain deficiency", "description": "" }, { "id": "MONDO:0009068", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009068", "name": "Complex IV deficiency", "description": "" }, { "id": "MONDO:0009068", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009068", "name": "Cox deficiency", "description": "" }, { "id": "MONDO:0009068", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009068", "name": "cytochrome C oxidase deficiency", "description": "" }, { "id": "MONDO:0009068", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009068", "name": "deficiency of mitochondrial respiratory chain complex4", "description": "" }, { "id": "MONDO:0009068", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009068", "name": "isolated cytochrome C oxidase deficiency", "description": "" }, { "id": "MONDO:0009068", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009068", "name": "mitochondrial Complex 4 deficiency", "description": "" }, { "id": "MIM:220110", "resource": "MIM", "url": "https://www.omim.org/entry/220110", "name": "Mitochondrial complex IV deficiency", "description": "Mitochondrial complex IV deficiency" } ], "evidence": [ { "id": "3762", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3762" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q94514", "url": "https://www.uniprot.org/uniprot/Q94514" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "COX5A", "url": "https://www.uniprot.org/uniprot/Q94514", "locus": { "chromosome": "3R", "start_pos": 11820299, "end_pos": 11819359, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0019624", "url": "https://www.ensembl.org/id/FBgn0019624" } ] } } ], "crossref": [ { "id": "FBgn0019624", "url": "https://bgee.org/?page=gene&gene_id=FBgn0019624", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00923", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00923", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0019624", "url": "https://flybase.org/reports/FBgn0019624", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "41432", "url": "https://www.ncbi.nlm.nih.gov/gene/41432", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q94514", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q94514*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003204", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003204", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036545", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036545", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG14724", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG14724", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "ENKNQYQ", "url": "https://omabrowser.org/oma/group/ENKNQYQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2876967at2759", "url": "http://www.orthodb.org/?query=2876967at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR14200", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14200", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14200:SF11", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14200:SF11", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02284", "url": "http://pfam.xfam.org/family/PF02284", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q94514", "url": "http://purl.obolibrary.org/obo/PR_Q94514", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DME-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5628897", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-611105", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-9707564", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9707564", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001262488", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262488", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0B4KFT0", "url": "https://www.uniprot.org/uniprot/A0A0B4KFT0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0B4KFT0-1", "url": "https://www.uniprot.org/uniprot/A0A0B4KFT0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q94514", "url": "https://www.uniprot.org/uniprot/Q94514", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q94514-1", "url": "https://www.uniprot.org/uniprot/Q94514-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLSITARNLASALRSSLVGTSSRVAAVRCLHGTEESAEEFDKRYEKYFSREGIDGWEIRKGMNDLLGMDLVPSPKIIEAGLRASRRVNDIALAIRWLEGCKDKCGDQKATLYPYLLEKITPTLQELGIPTIEELGYDKPELALKSVYDA", "length": 149, "header": "sp|Q94514-1|COX5A_DROME Isoform 1 of Cytochrome c oxidase subunit 5A, mitochondrial OS=Drosophila melanogaster OX=7227 GN=COX5A PE=2 SV=2 CANONICAL=Q94514-1" }, "isoforms": [ { "isoform_ac": "A0A0B4KFT0-1", "url": "", "sequence": { "sequence": "MLSITARNLASALRSSLVGTSSRVAAVRCLHGTEESAEEFDKRYEKYFSREGIDGWEIRKGMNDLLGMDLVPSPKIIEAGLRASRRVNDIALAIRWLEGCKDKCGDQKATLYPYLLEKITPTLQELGIPTIEELGYDKPELALKSVYDA", "length": 149, "header": "tr|A0A0B4KFT0-1|A0A0B4KFT0_DROME Computationally mapped isoform of Cytochrome c oxidase subunit 5A, mitochondrial OS=Drosophila melanogaster OX=7227 GN=COX5A PE=3 SV=1 CANONICAL=Q94514-1" }, "locus": { "chromosome": "3R", "start_pos": 11820158, "end_pos": 11819712, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0082474", "url": "https://www.ensembl.org/id/FBtr0082474" }, { "database": "Ensembl Peptide", "id": "FBpp0081948", "url": "https://www.ensembl.org/id/FBpp0081948" } ] } }, { "isoform_ac": "Q94514-1", "url": "", "sequence": { "sequence": "MLSITARNLASALRSSLVGTSSRVAAVRCLHGTEESAEEFDKRYEKYFSREGIDGWEIRKGMNDLLGMDLVPSPKIIEAGLRASRRVNDIALAIRWLEGCKDKCGDQKATLYPYLLEKITPTLQELGIPTIEELGYDKPELALKSVYDA", "length": 149, "header": "sp|Q94514-1|COX5A_DROME Isoform 1 of Cytochrome c oxidase subunit 5A, mitochondrial OS=Drosophila melanogaster OX=7227 GN=COX5A PE=2 SV=2 CANONICAL=Q94514-1" }, "locus": { "chromosome": "3R", "start_pos": 11820158, "end_pos": 11819712, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0082474", "url": "https://www.ensembl.org/id/FBtr0082474" }, { "database": "Ensembl Peptide", "id": "FBpp0081948", "url": "https://www.ensembl.org/id/FBpp0081948" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Identification of nuclear genes encoding mitochondrial proteins: isolation of a collection of D. melanogaster cDNAs homologous to sequences in the Human Gene Index database.", "journal": "Mol. Gen. Genet.", "date": "1999", "authors": "Barsanti P., Caggese C., Caizzi R., Moschetti R., Perrini B., Ragone G., de Pinto V.", "evidence": [ { "database": "UniProtKB", "id": "Q94514", "url": "https://www.uniprot.org/uniprot/Q94514" } ], "reference": [ { "type": "PubMed", "id": "10071211", "url": "https://glygen.org/publication/PubMed/10071211" } ] }, { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q94514", "url": "https://www.uniprot.org/uniprot/Q94514" }, { "database": "UniProtKB", "id": "A0A0B4KFT0", "url": "https://www.uniprot.org/uniprot/A0A0B4KFT0" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.", "journal": "Genome Biol.", "date": "2002", "authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KFT0", "url": "https://www.uniprot.org/uniprot/A0A0B4KFT0" } ], "reference": [ { "type": "PubMed", "id": "12537568", "url": "https://glygen.org/publication/PubMed/12537568" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q94514", "url": "https://www.uniprot.org/uniprot/Q94514" }, { "database": "UniProtKB", "id": "A0A0B4KFT0", "url": "https://www.uniprot.org/uniprot/A0A0B4KFT0" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.", "journal": "Genome Biol.", "date": "2002", "authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KFT0", "url": "https://www.uniprot.org/uniprot/A0A0B4KFT0" } ], "reference": [ { "type": "PubMed", "id": "12537573", "url": "https://glygen.org/publication/PubMed/12537573" } ] }, { "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.", "journal": "Genome Biol.", "date": "2002", "authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KFT0", "url": "https://www.uniprot.org/uniprot/A0A0B4KFT0" } ], "reference": [ { "type": "PubMed", "id": "12537574", "url": "https://glygen.org/publication/PubMed/12537574" } ] }, { "title": "Combined evidence annotation of transposable elements in genome sequences.", "journal": "PLoS Comput. Biol.", "date": "2005", "authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KFT0", "url": "https://www.uniprot.org/uniprot/A0A0B4KFT0" } ], "reference": [ { "type": "PubMed", "id": "16110336", "url": "https://glygen.org/publication/PubMed/16110336" } ] }, { "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Smith CD, Shu S, Mungall CJ, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KFT0", "url": "https://www.uniprot.org/uniprot/A0A0B4KFT0" } ], "reference": [ { "type": "PubMed", "id": "17569856", "url": "https://glygen.org/publication/PubMed/17569856" } ] }, { "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KFT0", "url": "https://www.uniprot.org/uniprot/A0A0B4KFT0" } ], "reference": [ { "type": "PubMed", "id": "17569867", "url": "https://glygen.org/publication/PubMed/17569867" } ] }, { "title": "The Release 6 reference sequence of the Drosophila melanogaster genome.", "journal": "Genome Res.", "date": "2015", "authors": "Hoskins RA, Carlson JW, Wan KH, Park S, Mendez I, Galle SE, Booth BW, Pfeiffer BD, George RA, Svirskas R, Krzywinski M, Schein J, Accardo MC, Damia E, Messina G, Mendez-Lago M, de Pablos B, Demakova OV, Andreyeva EN, Boldyreva LV, Marra M, Carvalho AB, Dimitri P, Villasante A, Zhimulev IF, Rubin GM, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KFT0", "url": "https://www.uniprot.org/uniprot/A0A0B4KFT0" } ], "reference": [ { "type": "PubMed", "id": "25589440", "url": "https://glygen.org/publication/PubMed/25589440" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: The Rule-Benders.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Crosby MA, Gramates LS, Dos Santos G, Matthews BB, St Pierre SE, Zhou P, Schroeder AJ, Falls K, Emmert DB, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KFT0", "url": "https://www.uniprot.org/uniprot/A0A0B4KFT0" } ], "reference": [ { "type": "PubMed", "id": "26109356", "url": "https://glygen.org/publication/PubMed/26109356" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Matthews BB, Dos Santos G, Crosby MA, Emmert DB, St Pierre SE, Gramates LS, Zhou P, Schroeder AJ, Falls K, Strelets V, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KFT0", "url": "https://www.uniprot.org/uniprot/A0A0B4KFT0" } ], "reference": [ { "type": "PubMed", "id": "26109357", "url": "https://glygen.org/publication/PubMed/26109357" } ] } ], "pathway": [ { "id": "dme:Dmel_CG14724", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG14724", "resource": "KEGG Pathway" }, { "id": "R-DME-5628897", "name": "TP53 Regulates Metabolic Genes", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5628897", "resource": "Reactome", "description": "TP53 Regulates Metabolic Genes" }, { "id": "R-DME-611105", "name": "Respiratory electron transport", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-611105", "resource": "Reactome", "description": "Respiratory electron transport" }, { "id": "R-DME-9707564", "name": "Cytoprotection by HMOX1", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9707564", "resource": "Reactome", "description": "Cytoprotection by HMOX1" } ], "orthologs": [ { "uniprot_canonical_ac": "P00427-1", "protein_name": "Cytochrome c oxidase subunit 6, mitochondrial", "gene_name": "COX6", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFEEFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVNDLPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS", "length": 148 }, "evidence": [ { "id": "Q94514", "url": "https://omabrowser.org/oma/group/Q94514/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "P12787-1", "protein_name": "Cytochrome c oxidase subunit 5A, mitochondrial", "gene_name": "Cox5a", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MLAAALRRCTAAAAARGLLHPASAPSPAAAVCSIRCYSHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV", "length": 146 }, "evidence": [ { "id": "Q94514", "url": "https://omabrowser.org/oma/group/Q94514/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P20674-1", "protein_name": "Cytochrome c oxidase subunit 5A, mitochondrial", "gene_name": "COX5A", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MLGAALRRCAVAATTRADPRGLLHSARTPGPAVAIQSVRCYSHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV", "length": 150 }, "evidence": [ { "id": "Q94514", "url": "https://omabrowser.org/oma/group/Q94514/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q94514", "url": "https://www.uniprot.org/uniprot/Q94514" } ], "pmid": "" }, { "name": "mitochondrial respiratory chain complex IV", "id": "GO:0005751", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005751", "evidence": [ { "database": "UniProtKB", "id": "Q94514", "url": "https://www.uniprot.org/uniprot/Q94514" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q94514", "url": "https://www.uniprot.org/uniprot/Q94514" } ], "pmid": "" }, { "name": "oxidoreductase activity", "id": "GO:0016491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016491", "evidence": [ { "database": "UniProtKB", "id": "Q94514", "url": "https://www.uniprot.org/uniprot/Q94514" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "positive regulation of cell cycle", "id": "GO:0045787", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045787", "evidence": [ { "database": "UniProtKB", "id": "Q94514", "url": "https://www.uniprot.org/uniprot/Q94514" } ], "pmid": "" }, { "name": "mitochondrial electron transport, cytochrome c to oxygen", "id": "GO:0006123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006123", "evidence": [ { "database": "UniProtKB", "id": "Q94514", "url": "https://www.uniprot.org/uniprot/Q94514" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }