{ "uniprot_canonical_ac": "Q92887-1", "uniprot_ac": "Q92887", "uniprot_id": "MRP2_HUMAN", "mass": { "chemical_mass": 174207.0, "monoisotopic_mass": 174207.0 }, "refseq": { "ac": "NP_000383", "name": "ATP-binding cassette sub-family C member 2", "summary": "The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000383" }, "gene_names": [ { "name": "ABCC2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q92887", "id": "Q92887" }, { "name": "ABC30; CMOAT; cMRP; DJS; MRP2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000383", "id": "NP_000383" }, { "name": "ABCC2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000383", "id": "NP_000383" }, { "name": "CMOAT1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q92887", "id": "Q92887" }, { "name": "CMOAT", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q92887", "id": "Q92887" }, { "name": "CMRP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q92887", "id": "Q92887" }, { "name": "MRP2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q92887", "id": "Q92887" } ], "protein_names": [ { "name": "ATP-binding cassette sub-family C member 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q92887" }, { "name": "7.6.2.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q92887" }, { "name": "7.6.2.2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q92887" }, { "name": "7.6.2.3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q92887" }, { "name": "ATP-binding cassette sub-family C member 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000383", "id": "NP_000383" }, { "name": "Canalicular multidrug resistance protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q92887" }, { "name": "Canalicular multispecific organic anion transporter 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q92887" }, { "name": "Multidrug resistance-associated protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q92887" }, { "name": "canalicular multispecific organic anion transporter 1; canalicular multidrug resistance protein; multidrug resistance-associated protein 2; ATP-binding cassette, sub-family C (CFTR/MRP), member 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000383", "id": "NP_000383" } ], "function": [ { "annotation": "ATP-dependent transporter of the ATP-binding cassette (ABC) family that binds and hydrolyzes ATP to enable active transport of various substrates including many drugs, toxicants and endogenous compound across cell membranes. Transports a wide variety of conjugated organic anions such as sulfate-, glucuronide- and glutathione (GSH)-conjugates of endo- and xenobiotics substrates (PubMed:10220572, PubMed:10421658, PubMed:11500505, PubMed:16332456). Mediates hepatobiliary excretion of mono- and bis-glucuronidated bilirubin molecules and therefore play an important role in bilirubin detoxification (PubMed:10421658). Mediates also hepatobiliary excretion of others glucuronide conjugates such as 17beta-estradiol 17-glucosiduronic acid and leukotriene C4 (PubMed:11500505). Transports sulfated bile salt such as taurolithocholate sulfate (PubMed:16332456). Transports various anticancer drugs, such as anthracycline, vinca alkaloid and methotrexate and HIV-drugs such as protease inhibitors (PubMed:10220572, PubMed:11500505, PubMed:12441801). Confers resistance to several anti-cancer drugs including cisplatin, doxorubicin, epirubicin, methotrexate, etoposide and vincristine (PubMed:10220572, PubMed:11500505).", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887#function" }, { "database": "PubMed", "id": "11500505", "url": "https://glygen.org/publication/PubMed/11500505" }, { "database": "PubMed", "id": "10421658", "url": "https://glygen.org/publication/PubMed/10421658" }, { "database": "PubMed", "id": "16332456", "url": "https://glygen.org/publication/PubMed/16332456" }, { "database": "PubMed", "id": "10220572", "url": "https://glygen.org/publication/PubMed/10220572" }, { "database": "PubMed", "id": "12441801", "url": "https://glygen.org/publication/PubMed/12441801" } ] }, { "annotation": "Association Between ABCG2, ABCB1, ABCC2 Efflux Transporter Single-Nucleotide Variants and Irinotecan Adverse Effects in Patients With Colorectal Cancer: A Real-Life Study.", "evidence": [ { "database": "RefSeq", "id": "NP_000383", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000383" }, { "database": "PubMed", "id": "36537755", "url": "https://glygen.org/publication/PubMed/36537755" } ] }, { "annotation": "Concurrence of novel mutations causing Gilbert's and Dubin-Johnson syndrome with poor clinical outcomes in a Han Chinese family.", "evidence": [ { "database": "RefSeq", "id": "NP_000383", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000383" }, { "database": "PubMed", "id": "36274106", "url": "https://glygen.org/publication/PubMed/36274106" } ] }, { "annotation": "Effects of splicing-regulatory polymorphisms in ABCC2, ABCG2, and ABCB1 on methotrexate exposure in Chinese children with acute lymphoblastic leukemia.", "evidence": [ { "database": "RefSeq", "id": "NP_000383", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000383" }, { "database": "PubMed", "id": "36463535", "url": "https://glygen.org/publication/PubMed/36463535" } ] }, { "annotation": "Genetic variations in ABC transporter genes as a predictive biomarker for toxicity in North Indian lung cancer patients undergoing platinum-based doublet chemotherapy.", "evidence": [ { "database": "RefSeq", "id": "NP_000383", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000383" }, { "database": "PubMed", "id": "36507589", "url": "https://glygen.org/publication/PubMed/36507589" } ] }, { "annotation": "The 5'-untranslated region of MRP2 markedly influences MRP2 mRNA translation regulation.", "evidence": [ { "database": "RefSeq", "id": "NP_000383", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000383" }, { "database": "PubMed", "id": "19890061", "url": "https://glygen.org/publication/PubMed/19890061" } ] }, { "annotation": "The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_000383", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000383" } ] } ], "disease": [ { "disease_id": "DOID:12308", "recommended_name": { "id": "DOID:12308", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12308", "name": "Dubin-Johnson syndrome", "description": "A bilirubin metabolic disorder that involves elevated levels of unconjugated bilirubin without elevation of liver alanine transaminase and aspartate transaminase enzymes as a result of the deficient ability of hepatocytes to secrete conjugated bilirubin into the bile." }, "synonyms": [ { "id": "DOID:12308", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12308", "name": "Dubin Johnson syndrome", "description": "" }, { "id": "DOID:12308", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12308", "name": "chronic idiopathic jaundice", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "Dubin-Johnson syndrome", "description": "Dubin-Johnson syndrome (DJS) is a benign, inherited liver disorder characterized clinically by chronic, predominantly conjugated, hyperbilirubinemia and histopathologically by black-brown pigment deposition in parenchymal liver cells." }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "Dubin Johnson syndrome", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "Dubin-Johnson syndrome", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "Dubin-Sprinz disease", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "Sprinz-Nelson syndrome", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "chronic idiopathic jaundice", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "hyperbilirubinemia type 2", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "DJS", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "conjugated hyperbilirubinemia", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "hyperbilirubinemia 2", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "hyperbilirubinemia, Dubin-Johnson type", "description": "" }, { "id": "MIM:237500", "resource": "MIM", "url": "https://www.omim.org/entry/237500", "name": "Dubin-Johnson syndrome", "description": "Dubin-Johnson syndrome" } ], "evidence": [ { "id": "237500", "database": "MIM", "url": "https://www.omim.org/entry/237500" } ] } ], "snv": [ { "evidence": [ { "id": "rs1334632932", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1334632932" }, { "id": "rs1334632932", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1334632932" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 1011, "end_pos": 1011, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "10", "chr_pos": "99831758", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1011", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs375785245", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375785245" }, { "id": "rs375785245", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375785245" }, { "id": "rs375785245", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375785245#frequency_tab" }, { "id": "rs375785245", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375785245" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1056, "end_pos": 1056, "sequence_org": "L", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NIL->NIS).", "chr_id": "10", "chr_pos": "99832040", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "L1056", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1164003492", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1164003492" }, { "id": "rs1164003492", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1164003492" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1164, "end_pos": 1164, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SET->NET).", "chr_id": "10", "chr_pos": "99836167", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1164", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1355618741", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1355618741" }, { "id": "rs1355618741", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1355618741" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1232, "end_pos": 1232, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TLS->NLS).", "chr_id": "10", "chr_pos": "99842047", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1232", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775999587", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775999587" }, { "id": "rs775999587", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775999587" }, { "id": "rs775999587", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775999587#frequency_tab" }, { "id": "rs775999587", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775999587" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 163, "end_pos": 163, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLA->NLT).", "chr_id": "10", "chr_pos": "99793910", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A163", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs56131651", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs56131651" }, { "id": "rs56131651", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs56131651" }, { "id": "rs56131651", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs56131651" }, { "id": "rs56131651", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs56131651#frequency_tab" }, { "id": "rs56131651", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs56131651" } ], "glycoeffect": [ "n-glyco-sequon-gain", "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 281, "end_pos": 281, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SQS->NQS).", "chr_id": "10", "chr_pos": "99797306", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.003994", "site_lbl": "S281", "disease": [ { "disease_id": "DOID:12308", "recommended_name": { "id": "DOID:12308", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12308", "name": "Dubin-Johnson syndrome", "description": "A bilirubin metabolic disorder that involves elevated levels of unconjugated bilirubin without elevation of liver alanine transaminase and aspartate transaminase enzymes as a result of the deficient ability of hepatocytes to secrete conjugated bilirubin into the bile." }, "synonyms": [ { "id": "DOID:12308", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12308", "name": "Dubin Johnson syndrome", "description": "" }, { "id": "DOID:12308", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12308", "name": "chronic idiopathic jaundice", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "Dubin-Johnson syndrome", "description": "Dubin-Johnson syndrome (DJS) is a benign, inherited liver disorder characterized clinically by chronic, predominantly conjugated, hyperbilirubinemia and histopathologically by black-brown pigment deposition in parenchymal liver cells." }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "Dubin Johnson syndrome", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "Dubin-Johnson syndrome", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "Dubin-Sprinz disease", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "Sprinz-Nelson syndrome", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "chronic idiopathic jaundice", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "hyperbilirubinemia type 2", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "DJS", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "conjugated hyperbilirubinemia", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "hyperbilirubinemia 2", "description": "" }, { "id": "MONDO:0009380", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009380", "name": "hyperbilirubinemia, Dubin-Johnson type", "description": "" }, { "id": "MIM:237500", "resource": "MIM", "url": "https://www.omim.org/entry/237500", "name": "Dubin-Johnson syndrome", "description": "Dubin-Johnson syndrome" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs146464095", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146464095" }, { "id": "rs146464095", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146464095" }, { "id": "rs146464095", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs146464095#frequency_tab" }, { "id": "rs146464095", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs146464095" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 406, "end_pos": 406, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TLS->NLS).", "chr_id": "10", "chr_pos": "99804026", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T406", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs963574514", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs963574514" }, { "id": "rs963574514", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs963574514" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 438, "end_pos": 438, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NFM->NFT).", "chr_id": "10", "chr_pos": "99804122", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M438", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs766877794", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766877794" }, { "id": "rs766877794", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766877794" }, { "id": "rs766877794", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766877794" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 648, "end_pos": 648, "sequence_org": "H", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (HDS->NDS).", "chr_id": "10", "chr_pos": "99811577", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "H648", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1475884280", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1475884280" }, { "id": "rs1475884280", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1475884280" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 931, "end_pos": 931, "sequence_org": "L", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSL->NSS).", "chr_id": "10", "chr_pos": "99830760", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "L931", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 1254, "end_pos": 1254, "sequence_org": "W", "sequence_mut": "A", "comment": "Fails to transport methotrexate, leukotriene C4 and estradiol glucuronide.", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" }, { "database": "PubMed", "id": "11500505", "url": "https://glygen.org/publication/PubMed/11500505" } ] }, { "start_pos": 1254, "end_pos": 1254, "sequence_org": "W", "sequence_mut": "C", "comment": "Fails to transport methotrexate, leukotriene C4 and estradiol glucuronide.", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" }, { "database": "PubMed", "id": "11500505", "url": "https://glygen.org/publication/PubMed/11500505" } ] }, { "start_pos": 1254, "end_pos": 1254, "sequence_org": "W", "sequence_mut": "F", "comment": "Fails to transport methotrexate and leukotriene C4. Does not affect estradiol glucuronide transport.", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" }, { "database": "PubMed", "id": "11500505", "url": "https://glygen.org/publication/PubMed/11500505" } ] }, { "start_pos": 1254, "end_pos": 1254, "sequence_org": "W", "sequence_mut": "Y", "comment": "Fails to transport methotrexate; reduces leukotriene C4 transport. Does not affect estradiol glucuronide transport.", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" }, { "database": "PubMed", "id": "11500505", "url": "https://glygen.org/publication/PubMed/11500505" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "77.12", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000023839", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000023839" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "43.78", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000023839", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000023839" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "51.84", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000023839", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000023839" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "63.85", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000023839", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000023839" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "71.34", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000023839", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000023839" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "62.75", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000023839", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000023839" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000023839", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000023839" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "61.28", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000023839", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000023839" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "54.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000023839", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000023839" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000023839", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000023839" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "93.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000023839", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000023839" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "56.02", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000023839", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000023839" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "58.98", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000023839", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000023839" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "Q92887", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q92887" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "Q92887", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q92887" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "Q92887", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q92887" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "Q92887", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q92887" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "Q92887", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q92887" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "Q92887", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q92887" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "Q92887", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q92887" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "Q92887", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q92887" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "Q92887", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q92887" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "Q92887", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q92887" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "Q92887", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q92887" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "Q92887", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q92887" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "common_name": "Human" } ], "gene": [ { "name": "ABCC2", "url": "https://www.uniprot.org/uniprot/Q92887", "locus": { "chromosome": "10", "start_pos": 74997, "end_pos": 5043, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_1208", "url": "https://www.ensembl.org/id/LRG_1208" } ] } } ], "crossref": [ { "id": "ENSG00000023839", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000023839", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "7.6.2.2", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=7.6.2.2&UniProtAcc=Q92887", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "7.6.2.3", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=7.6.2.3&UniProtAcc=Q92887", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd03244", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03244", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd03250", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03250", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd18595", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd18595", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd18603", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd18603", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL5748", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5748", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "ABCC2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ABCC2", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "1244", "url": "https://www.ncbi.nlm.nih.gov/gene/1244", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "53", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=53", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "Q92887", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q92887*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003439", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003439", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003593", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003593", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005292", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005292", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011527", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011527", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017871", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017871", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036640", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036640", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:1244", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1244", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "237500", "url": "http://www.omim.org/entry/237500", "database": "MIM", "categories": [ "Other" ] }, { "id": "601107", "url": "http://www.omim.org/entry/601107", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_Q92887", "url": "https://www.nextprot.org/entry/NX_Q92887", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "RRRYILW", "url": "https://omabrowser.org/oma/group/RRRYILW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3384185at2759", "url": "http://www.orthodb.org/?query=3384185at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24223", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24223", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24223:SF176", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24223:SF176", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00005", "url": "http://pfam.xfam.org/family/PF00005", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00664", "url": "http://pfam.xfam.org/family/PF00664", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "Q92887", "url": "https://pharos.nih.gov/targets/Q92887", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_Q92887", "url": "http://purl.obolibrary.org/obo/PR_Q92887", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-189483", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5679001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5679001", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9754706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000383", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000383", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "19121", "url": "https://www.rhea-db.org/rhea/19121", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "38963", "url": "https://www.rhea-db.org/rhea/38963", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "50084", "url": "https://www.rhea-db.org/rhea/50084", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "60128", "url": "https://www.rhea-db.org/rhea/60128", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66180", "url": "https://www.rhea-db.org/rhea/66180", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66192", "url": "https://www.rhea-db.org/rhea/66192", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A3B3IRU4", "url": "https://www.uniprot.org/uniprot/A0A3B3IRU4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B3IRU4-1", "url": "https://www.uniprot.org/uniprot/A0A3B3IRU4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B3IRZ2", "url": "https://www.uniprot.org/uniprot/A0A3B3IRZ2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B3IRZ2-1", "url": "https://www.uniprot.org/uniprot/A0A3B3IRZ2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B3IS94", "url": "https://www.uniprot.org/uniprot/A0A3B3IS94", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B3IS94-1", "url": "https://www.uniprot.org/uniprot/A0A3B3IS94-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B3ITG8", "url": "https://www.uniprot.org/uniprot/A0A3B3ITG8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B3ITG8-1", "url": "https://www.uniprot.org/uniprot/A0A3B3ITG8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q92887-1", "url": "https://www.uniprot.org/uniprot/Q92887-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLEKFCNSTFWNSSFLDSPEADLPLCFEQTVLVWIPLGYLWLLAPWQLLHVYKSRTKRSSTTKLYLAKQVFVGFLLILAAIELALVLTEDSGQATVPAVRYTNPSLYLGTWLLVLLIQYSRQWCVQKNSWFLSLFWILSILCGTFQFQTLIRTLLQGDNSNLAYSCLFFISYGFQILILIFSAFSENNESSNNPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKALFKTFYMVLLKSFLLKLVNDIFTFVSPQLLKLLISFASDRDTYLWIGYLCAILLFTAALIQSFCLQCYFQLCFKLGVKVRTAIMASVYKKALTLSNLARKEYTVGETVNLMSVDAQKLMDVTNFMHMLWSSVLQIVLSIFFLWRELGPSVLAGVGVMVLVIPINAILSTKSKTIQVKNMKNKDKRLKIMNEILSGIKILKYFAWEPSFRDQVQNLRKKELKNLLAFSQLQCVVIFVFQLTPVLVSVVTFSVYVLVDSNNILDAQKAFTSITLFNILRFPLSMLPMMISSMLQASVSTERLEKYLGGDDLDTSAIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLDIMAGQLVAVIGPVGSGKSSLISAMLGEMENVHGHITIKGTTAYVPQQSWIQNGTIKDNILFGTEFNEKRYQQVLEACALLPDLEMLPGGDLAEIGEKGINLSGGQKQRISLARATYQNLDIYLLDDPLSAVDAHVGKHIFNKVLGPNGLLKGKTRLLVTHSMHFLPQVDEIVVLGNGTIVEKGSYSALLAKKGEFAKNLKTFLRHTGPEEEATVHDGSEEEDDDYGLISSVEEIPEDAASITMRRENSFRRTLSRSSRSNGRHLKSLRNSLKTRNVNSLKEDEELVKGQKLIKKEFIETGKVKFSIYLEYLQAIGLFSIFFIILAFVMNSVAFIGSNLWLSAWTSDSKIFNSTDYPASQRDMRVGVYGALGLAQGIFVFIAHFWSAFGFVHASNILHKQLLNNILRAPMRFFDTTPTGRIVNRFAGDISTVDDTLPQSLRSWITCFLGIISTLVMICMATPVFTIIVIPLGIIYVSVQMFYVSTSRQLRRLDSVTRSPIYSHFSETVSGLPVIRAFEHQQRFLKHNEVRIDTNQKCVFSWITSNRWLAIRLELVGNLTVFFSALMMVIYRDTLSGDTVGFVLSNALNITQTLNWLVRMTSEIETNIVAVERITEYTKVENEAPWVTDKRPPPDWPSKGKIQFNNYQVRYRPELDLVLRGITCDIGSMEKIGVVGRTGAGKSSLTNCLFRILEAAGGQIIIDGVDIASIGLHDLREKLTIIPQDPILFSGSLRMNLDPFNNYSDEEIWKALELAHLKSFVASLQLGLSHEVTEAGGNLSIGQRQLLCLGRALLRKSKILVLDEATAAVDLETDNLIQTTIQNEFAHCTVITIAHRLHTIMDSDKVMVLDNGKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF", "length": 1545, "header": "sp|Q92887-1|MRP2_HUMAN Isoform 1 of ATP-binding cassette sub-family C member 2 OS=Homo sapiens OX=9606 GN=ABCC2 PE=1 SV=3 CANONICAL=Q92887-1" }, "isoforms": [ { "isoform_ac": "A0A3B3IRU4-1", "url": "", "sequence": { "sequence": "MLEKFCNSTFWNSSFLDSPEADLPLCFEQTVLVWIPLGYLWLLAPWQLLHVYKSRTKRSSTTKLYLAKQVFVGFLLILAAIELALVLTEDSGQATVPAVRYTNPSLYLGTWLLVLLIQYSRQWCVQKNSWFLSLFWILSILCGTFQFQTLIRTLLQGDNSNLAYSCLFFISYGFQILILIFSAFSENNESSNNPSSIASFLSSITYSWYDSYLGG", "length": 215, "header": "tr|A0A3B3IRU4-1|A0A3B3IRU4_HUMAN Computationally mapped isoform of ATP binding cassette subfamily C member 2 OS=Homo sapiens OX=9606 GN=ABCC2 PE=4 SV=1 CANONICAL=Q92887-1" }, "locus": { "chromosome": "10", "start_pos": 99796403, "end_pos": 99782845, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000649493.1", "url": "https://www.ensembl.org/id/ENST00000649493.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000496847.1", "url": "https://www.ensembl.org/id/ENSP00000496847.1" } ] } }, { "isoform_ac": "A0A3B3IRZ2-1", "url": "", "sequence": { "sequence": "MLEKFCNSTFWNSSFLDSPEADLPLCFEQTVLVWIPLGYLWLLAPWQLLHVYKSRTKRSSTTKLYLAKQVFVGFLLILAAIELALVLTEDSGQATVPAVRYTNPSLYLGTWLLVLLIQYSRQWCVQKNSWFLSLFWILSILCGTFQFQTLIRTLLQGDNSNLAYSCLFFISYGFQILILIFSAFSENNESSNVRF", "length": 195, "header": "tr|A0A3B3IRZ2-1|MRP2_HUMAN Computationally mapped isoform of ATP-binding cassette sub-family C member 2 OS=Homo sapiens OX=9606 GN=ABCC2 PE=1 SV=1 CANONICAL=Q92887-1" }, "locus": { "chromosome": "10", "start_pos": 99794008, "end_pos": 99782845, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000649932.1", "url": "https://www.ensembl.org/id/ENST00000649932.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000498120.1", "url": "https://www.ensembl.org/id/ENSP00000498120.1" } ] } }, { "isoform_ac": "A0A3B3IS94-1", "url": "", "sequence": { "sequence": "MLEKFCNSTFWNSSFLDSPEADLPLCFEQTVLVWIPLGYLWLLAPWQLLHVYKSRTKRSSTTKLYLAKQVFVGFLLILAAIELALVLTEDSGQATVPAVRYTNPSLYLGTWLLVLLIQYSRQWCVQKNSWFLSLFWILSILCGTFQFQTLIRTLLQGDNSNLAYSCLFFISYGFQILILIFSAFSENNESSNNPSSIASFLSSITYSWYDRRGGVCL", "length": 217, "header": "tr|A0A3B3IS94-1|MRP2_HUMAN Computationally mapped isoform of ATP-binding cassette sub-family C member 2 OS=Homo sapiens OX=9606 GN=ABCC2 PE=1 SV=1 CANONICAL=Q92887-1" }, "locus": { "chromosome": "10", "start_pos": 99796381, "end_pos": 99782845, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000648324.1", "url": "https://www.ensembl.org/id/ENST00000648324.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000497248.1", "url": "https://www.ensembl.org/id/ENSP00000497248.1" } ] } }, { "isoform_ac": "A0A3B3ITG8-1", "url": "", "sequence": { "sequence": "XDLREKLTIIPQDPILFSGSLRMNLDPFNNYSDEEIWKALELAHLKSFVASLQLGLSHEVTEAGGNLRGKLEVHLG", "length": 76, "header": "tr|A0A3B3ITG8-1|MRP2_HUMAN Computationally mapped isoform of ATP-binding cassette sub-family C member 2 OS=Homo sapiens OX=9606 GN=ABCC2 PE=1 SV=1 CANONICAL=Q92887-1" }, "locus": { "chromosome": "10", "start_pos": 99849750, "end_pos": 99845749, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000648523.1", "url": "https://www.ensembl.org/id/ENST00000648523.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000497778.1", "url": "https://www.ensembl.org/id/ENSP00000497778.1" } ] } }, { "isoform_ac": "Q92887-1", "url": "", "sequence": { "sequence": "MLEKFCNSTFWNSSFLDSPEADLPLCFEQTVLVWIPLGYLWLLAPWQLLHVYKSRTKRSSTTKLYLAKQVFVGFLLILAAIELALVLTEDSGQATVPAVRYTNPSLYLGTWLLVLLIQYSRQWCVQKNSWFLSLFWILSILCGTFQFQTLIRTLLQGDNSNLAYSCLFFISYGFQILILIFSAFSENNESSNNPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKALFKTFYMVLLKSFLLKLVNDIFTFVSPQLLKLLISFASDRDTYLWIGYLCAILLFTAALIQSFCLQCYFQLCFKLGVKVRTAIMASVYKKALTLSNLARKEYTVGETVNLMSVDAQKLMDVTNFMHMLWSSVLQIVLSIFFLWRELGPSVLAGVGVMVLVIPINAILSTKSKTIQVKNMKNKDKRLKIMNEILSGIKILKYFAWEPSFRDQVQNLRKKELKNLLAFSQLQCVVIFVFQLTPVLVSVVTFSVYVLVDSNNILDAQKAFTSITLFNILRFPLSMLPMMISSMLQASVSTERLEKYLGGDDLDTSAIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLDIMAGQLVAVIGPVGSGKSSLISAMLGEMENVHGHITIKGTTAYVPQQSWIQNGTIKDNILFGTEFNEKRYQQVLEACALLPDLEMLPGGDLAEIGEKGINLSGGQKQRISLARATYQNLDIYLLDDPLSAVDAHVGKHIFNKVLGPNGLLKGKTRLLVTHSMHFLPQVDEIVVLGNGTIVEKGSYSALLAKKGEFAKNLKTFLRHTGPEEEATVHDGSEEEDDDYGLISSVEEIPEDAASITMRRENSFRRTLSRSSRSNGRHLKSLRNSLKTRNVNSLKEDEELVKGQKLIKKEFIETGKVKFSIYLEYLQAIGLFSIFFIILAFVMNSVAFIGSNLWLSAWTSDSKIFNSTDYPASQRDMRVGVYGALGLAQGIFVFIAHFWSAFGFVHASNILHKQLLNNILRAPMRFFDTTPTGRIVNRFAGDISTVDDTLPQSLRSWITCFLGIISTLVMICMATPVFTIIVIPLGIIYVSVQMFYVSTSRQLRRLDSVTRSPIYSHFSETVSGLPVIRAFEHQQRFLKHNEVRIDTNQKCVFSWITSNRWLAIRLELVGNLTVFFSALMMVIYRDTLSGDTVGFVLSNALNITQTLNWLVRMTSEIETNIVAVERITEYTKVENEAPWVTDKRPPPDWPSKGKIQFNNYQVRYRPELDLVLRGITCDIGSMEKIGVVGRTGAGKSSLTNCLFRILEAAGGQIIIDGVDIASIGLHDLREKLTIIPQDPILFSGSLRMNLDPFNNYSDEEIWKALELAHLKSFVASLQLGLSHEVTEAGGNLSIGQRQLLCLGRALLRKSKILVLDEATAAVDLETDNLIQTTIQNEFAHCTVITIAHRLHTIMDSDKVMVLDNGKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF", "length": 1545, "header": "sp|Q92887-1|MRP2_HUMAN Isoform 1 of ATP-binding cassette sub-family C member 2 OS=Homo sapiens OX=9606 GN=ABCC2 PE=1 SV=3 CANONICAL=Q92887-1" }, "locus": { "chromosome": "10", "start_pos": 99851628, "end_pos": 99782845, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000647814.1", "url": "https://www.ensembl.org/id/ENST00000647814.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000497274.1", "url": "https://www.ensembl.org/id/ENSP00000497274.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1011, "start_aa": "Asn", "end_pos": 1011, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1011", "evidence": [ { "id": "Q92887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92887#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 12, "start_aa": "Asn", "end_pos": 12, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn12", "evidence": [ { "id": "Q92887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92887#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 7, "start_aa": "Asn", "end_pos": 7, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn7", "evidence": [ { "id": "Q92887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92887#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 1378, "end_pos": 1378, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr1378" }, { "start_pos": 1438, "end_pos": 1438, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" } ], "site_lbl": "Ser1438" }, { "start_pos": 1542, "end_pos": 1542, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" }, { "database": "PubMed", "id": "12615054", "url": "https://glygen.org/publication/PubMed/12615054" } ], "site_lbl": "Ser1542" }, { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "site_lbl": "Ser281" }, { "start_pos": 283, "end_pos": 283, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "phospho.ELM", "id": "Q92887", "url": "http://phospho.elm.eu.org/byAccession/Q92887.html" } ], "site_lbl": "Ser283" }, { "start_pos": 602, "end_pos": 602, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser602" }, { "start_pos": 609, "end_pos": 609, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser609" }, { "start_pos": 616, "end_pos": 616, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ], "site_lbl": "Tyr616" }, { "start_pos": 723, "end_pos": 723, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr723" }, { "start_pos": 873, "end_pos": 873, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "Q92887", "url": "http://phospho.elm.eu.org/byAccession/Q92887.html" } ], "site_lbl": "Thr873" }, { "start_pos": 878, "end_pos": 878, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "phospho.ELM", "id": "Q92887", "url": "http://phospho.elm.eu.org/byAccession/Q92887.html" } ], "site_lbl": "Ser878" }, { "start_pos": 885, "end_pos": 885, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "Q92887", "url": "http://phospho.elm.eu.org/byAccession/Q92887.html" } ], "site_lbl": "Tyr885" }, { "start_pos": 900, "end_pos": 900, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "Q92887", "url": "http://phospho.elm.eu.org/byAccession/Q92887.html" } ], "site_lbl": "Ser900" }, { "start_pos": 926, "end_pos": 926, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" } ], "site_lbl": "Ser926" }, { "start_pos": 930, "end_pos": 930, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" } ], "site_lbl": "Ser930" }, { "start_pos": 938, "end_pos": 938, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ], "site_lbl": "Ser938" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Genomic structure of the canalicular multispecific organic anion-transporter gene (MRP2/cMOAT) and mutations in the ATP-binding-cassette region in Dubin-Johnson syndrome.", "journal": "Am. J. Hum. Genet.", "date": "1999", "authors": "Toh S, Wada M, Uchiumi T, Inokuchi A, Makino Y, Horie Y, Adachi Y, Sakisaka S, Kuwano M", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "reference": [ { "type": "PubMed", "id": "10053008", "url": "https://glygen.org/publication/PubMed/10053008" } ] }, { "title": "Drug resistance and ATP-dependent conjugate transport mediated by the apical multidrug resistance protein, MRP2, permanently expressed in human and canine cells.", "journal": "Mol. Pharmacol.", "date": "1999", "authors": "Cui Y, Konig J, Buchholz JK, Spring H, Leier I, Keppler D", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" }, { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "10220572", "url": "https://glygen.org/publication/PubMed/10220572" } ] }, { "title": "Transport of monoglucuronosyl and bisglucuronosyl bilirubin by recombinant human and rat multidrug resistance protein 2.", "journal": "Hepatology", "date": "1999", "authors": "Kamisako T, Leier I, Cui Y, Konig J, Buchholz U, Hummel-Eisenbeiss J, Keppler D", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" }, { "database": "Reactome", "id": "R-HSA-189483", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483" } ], "reference": [ { "type": "PubMed", "id": "10421658", "url": "https://glygen.org/publication/PubMed/10421658" } ] }, { "title": "Characterization of the CoA ligases of human liver mitochondria catalyzing the activation of short- and medium-chain fatty acids and xenobiotic carboxylic acids.", "journal": "Biochimica et biophysica acta", "date": "1999", "authors": "Vessey DA, Kelley M, Warren RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "10434065", "url": "https://glygen.org/publication/PubMed/10434065" } ] }, { "title": "Exon-intron organization of the human multidrug-resistance protein 2 (MRP2) gene mutated in Dubin-Johnson syndrome.", "journal": "Gastroenterology", "date": "1999", "authors": "Tsujii H, Konig J, Rost D, Stockel B, Leuschner U, Keppler D", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "reference": [ { "type": "PubMed", "id": "10464142", "url": "https://glygen.org/publication/PubMed/10464142" } ] }, { "title": "Profound differences in the transport of steroids by two mouse P-glycoproteins.", "journal": "Biochemical pharmacology", "date": "1999", "authors": "Gruol DJ, Vo QD, Zee MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "10484077", "url": "https://glygen.org/publication/PubMed/10484077" } ] }, { "title": "A novel human hepatic organic anion transporting polypeptide (OATP2). Identification of a liver-specific human organic anion transporting polypeptide and identification of rat and human hydroxymethylglutaryl-CoA reductase inhibitor transporters.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Hsiang B, Zhu Y, Wang Z, Wu Y, Sasseville V, Yang WP, Kirchgessner TG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706" } ], "reference": [ { "type": "PubMed", "id": "10601278", "url": "https://glygen.org/publication/PubMed/10601278" } ] }, { "title": "Initial-rate kinetics of the flavin reductase reaction catalysed by human biliverdin-IXbeta reductase (BVR-B).", "journal": "The Biochemical journal", "date": "2000", "authors": "Cunningham O, Gore MG, Mantle TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-189483", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483" } ], "reference": [ { "type": "PubMed", "id": "10620517", "url": "https://glygen.org/publication/PubMed/10620517" } ] }, { "title": "A novel human organic anion transporting polypeptide localized to the basolateral hepatocyte membrane.", "journal": "American journal of physiology. Gastrointestinal and liver physiology", "date": "2000", "authors": "Konig J, Cui Y, Nies AT, Keppler D", "evidence": [ { "database": "Reactome", "id": "R-HSA-189483", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483" } ], "reference": [ { "type": "PubMed", "id": "10644574", "url": "https://glygen.org/publication/PubMed/10644574" } ] }, { "title": "Interaction of docetaxel (`Taxotere`) with human P-glycoprotein.", "journal": "Japanese journal of cancer research : Gann", "date": "1999", "authors": "Shirakawa K, Takara K, Tanigawara Y, Aoyama N, Kasuga M, Komada F, Sakaeda T, Okumura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "10665657", "url": "https://glygen.org/publication/PubMed/10665657" } ] }, { "title": "Contribution of CYP2E1 and CYP3A to acetaminophen reactive metabolite formation.", "journal": "Clinical pharmacology and therapeutics", "date": "2000", "authors": "Manyike PT, Kharasch ED, Kalhorn TF, Slattery JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "10741631", "url": "https://glygen.org/publication/PubMed/10741631" } ] }, { "title": "Characterization of ABCB9, an ATP binding cassette protein associated with lysosomes.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Zhang F, Zhang W, Liu L, Fisher CL, Hui D, Childs S, Dorovini-Zis K, Ling V", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "10748049", "url": "https://glygen.org/publication/PubMed/10748049" } ] }, { "title": "Recent advances in bilirubin metabolism research: the molecular mechanism of hepatocyte bilirubin transport and its clinical relevance.", "journal": "Journal of gastroenterology", "date": "2000", "authors": "Kamisako T, Kobayashi Y, Takeuchi K, Ishihara T, Higuchi K, Tanaka Y, Gabazza EC, Adachi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-189483", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483" } ], "reference": [ { "type": "PubMed", "id": "11023036", "url": "https://glygen.org/publication/PubMed/11023036" } ] }, { "title": "Lactonization is the critical first step in the disposition of the 3-hydroxy-3-methylglutaryl-CoA reductase inhibitor atorvastatin.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2000", "authors": "Jacobsen W, Kuhn B, Soldner A, Kirchner G, Sewing KF, Kollman PA, Benet LZ, Christians U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706" } ], "reference": [ { "type": "PubMed", "id": "11038166", "url": "https://glygen.org/publication/PubMed/11038166" } ] }, { "title": "Impaired protein maturation of the conjugate export pump multidrug resistance protein 2 as a consequence of a deletion mutation in Dubin-Johnson syndrome.", "journal": "Hepatology", "date": "2000", "authors": "Keitel V, Kartenbeck J, Nies AT, Spring H, Brom M, Keppler D", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "reference": [ { "type": "PubMed", "id": "11093739", "url": "https://glygen.org/publication/PubMed/11093739" } ] }, { "title": "Hepatic uptake of bilirubin and its conjugates by the human organic anion transporter SLC21A6.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Cui Y, Konig J, Leier I, Buchholz U, Keppler D", "evidence": [ { "database": "Reactome", "id": "R-HSA-189483", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483" } ], "reference": [ { "type": "PubMed", "id": "11134001", "url": "https://glygen.org/publication/PubMed/11134001" } ] }, { "title": "Polymorphism of the ABC transporter genes, MDR1, MRP1 and MRP2/cMOAT, in healthy Japanese subjects.", "journal": "Pharmacogenetics", "date": "2001", "authors": "Ito S, Ieiri I, Tanabe M, Suzuki A, Higuchi S, Otsubo K", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "reference": [ { "type": "PubMed", "id": "11266082", "url": "https://glygen.org/publication/PubMed/11266082" } ] }, { "title": "Isolation of a family of organic anion transporters from human liver and kidney.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Sun W, Wu RR, van Poelje PD, Erion MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "11327718", "url": "https://glygen.org/publication/PubMed/11327718" } ] }, { "title": "Affinity of human serum albumin for bilirubin varies with albumin concentration and buffer composition: results of a novel ultrafiltration method.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Weisiger RA, Ostrow JD, Koehler RK, Webster CC, Mukerjee P, Pascolo L, Tiribelli C", "evidence": [ { "database": "Reactome", "id": "R-HSA-189483", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483" } ], "reference": [ { "type": "PubMed", "id": "11397817", "url": "https://glygen.org/publication/PubMed/11397817" } ] }, { "title": "Identification and functional analysis of two novel mutations in the multidrug resistance protein 2 gene in Israeli patients with Dubin-Johnson syndrome.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Mor-Cohen R, Zivelin A, Rosenberg N, Shani M, Muallem S, Seligsohn U", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" }, { "database": "Reactome", "id": "R-HSA-5679001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5679001" } ], "reference": [ { "type": "PubMed", "id": "11477083", "url": "https://glygen.org/publication/PubMed/11477083" } ] }, { "title": "Mutation of Trp1254 in the multispecific organic anion transporter, multidrug resistance protein 2 (MRP2) (ABCC2), alters substrate specificity and results in loss of methotrexate transport activity.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Ito K, Oleschuk CJ, Westlake C, Vasa MZ, Deeley RG, Cole SP", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "reference": [ { "type": "PubMed", "id": "11500505", "url": "https://glygen.org/publication/PubMed/11500505" } ] }, { "title": "Kinetics of P-glycoprotein-mediated efflux of paclitaxel.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2001", "authors": "Jang SH, Wientjes MG, Au JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "11504826", "url": "https://glygen.org/publication/PubMed/11504826" } ] }, { "title": "Na+:HCO(3-) cotransporters (NBC): cloning and characterization.", "journal": "The Journal of membrane biology", "date": "2001", "authors": "Soleimani M, Burnham CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "11562789", "url": "https://glygen.org/publication/PubMed/11562789" } ] }, { "title": "The albumin binding of unconjugated bilirubin in serum.", "journal": "Clinical biochemistry", "date": "1975", "authors": "Griffiths WC, Diamond I, Dextraze P", "evidence": [ { "database": "Reactome", "id": "R-HSA-189483", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483" } ], "reference": [ { "type": "PubMed", "id": "1157293", "url": "https://glygen.org/publication/PubMed/1157293" } ] }, { "title": "Characterization of drug transport by the human multidrug resistance protein 3 (ABCC3).", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Zelcer N, Saeki T, Reid G, Beijnen JH, Borst P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "11581266", "url": "https://glygen.org/publication/PubMed/11581266" } ] }, { "title": "Interindividual variability in acetaminophen glucuronidation by human liver microsomes: identification of relevant acetaminophen UDP-glucuronosyltransferase isoforms.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2001", "authors": "Court MH, Duan SX, von Moltke LL, Greenblatt DJ, Patten CJ, Miners JO, Mackenzie PI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "11714888", "url": "https://glygen.org/publication/PubMed/11714888" } ] }, { "title": "A principal role for the proteasome in endoplasmic reticulum-associated degradation of misfolded intracellular cystic fibrosis transmembrane conductance regulator.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Gelman MS, Kannegaard ES, Kopito RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "11812794", "url": "https://glygen.org/publication/PubMed/11812794" } ] }, { "title": "Glucuronidation of statins in animals and humans: a novel mechanism of statin lactonization.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2002", "authors": "Prueksaritanont T, Subramanian R, Fang X, Ma B, Qiu Y, Lin JH, Pearson PG, Baillie TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706" } ], "reference": [ { "type": "PubMed", "id": "11950779", "url": "https://glygen.org/publication/PubMed/11950779" } ] }, { "title": "Functional analysis of ABCA8, a new drug transporter.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Tsuruoka S, Ishibashi K, Yamamoto H, Wakaumi M, Suzuki M, Schwartz GJ, Imai M, Fujimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "12379217", "url": "https://glygen.org/publication/PubMed/12379217" } ] }, { "title": "The role of the efflux transporter P-glycoprotein in brain penetration of prednisolone.", "journal": "The Journal of endocrinology", "date": "2002", "authors": "Karssen AM, Meijer OC, van der Sandt IC, De Boer AG, De Lange EC, De Kloet ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "12379510", "url": "https://glygen.org/publication/PubMed/12379510" } ] }, { "title": "The cystic fibrosis transmembrane conductance regulator interacts with and regulates the activity of the HCO3- salvage transporter human Na+-HCO3- cotransport isoform 3.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Park M, Ko SB, Choi JY, Muallem G, Thomas PJ, Pushkin A, Lee MS, Kim JY, Lee MG, Muallem S, Kurtz I", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "12403779", "url": "https://glygen.org/publication/PubMed/12403779" } ] }, { "title": "Multidrug resistance protein 2 (MRP2) transports HIV protease inhibitors, and transport can be enhanced by other drugs.", "journal": "AIDS", "date": "2002", "authors": "Beijnen J.H., Zelcer N., Schinkel A.H., Smit J.W., Crommentuyn K.M., Huisman M.T., Wiltshire H.R.", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "reference": [ { "type": "PubMed", "id": "12441801", "url": "https://glygen.org/publication/PubMed/12441801" } ] }, { "title": "Sequence identification and characterization of human carnosinase and a closely related non-specific dipeptidase.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Teufel M, Saudek V, Ledig JP, Bernhardt A, Boularand S, Carreau A, Cairns NJ, Carter C, Cowley DJ, Duverger D, Ganzhorn AJ, Guenet C, Heintzelmann B, Laucher V, Sauvage C, Smirnova T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "12473676", "url": "https://glygen.org/publication/PubMed/12473676" } ] }, { "title": "Distribution of STI-571 to the brain is limited by P-glycoprotein-mediated efflux.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2003", "authors": "Dai H, Marbach P, Lemaire M, Hayes M, Elmquist WF", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "12604685", "url": "https://glygen.org/publication/PubMed/12604685" } ] }, { "title": "C-terminal phosphorylation of MRP2 modulates its interaction with PDZ proteins.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Hegedus T, Sessler T, Scott R, Thelin W, Bakos E, Varadi A, Szabo K, Homolya L, Milgram SL, Sarkadi B", "evidence": [ { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" } ], "reference": [ { "type": "PubMed", "id": "12615054", "url": "https://glygen.org/publication/PubMed/12615054" } ] }, { "title": "Isolation, sequencing, and expression of a cDNA for the HXM-A form of xenobiotic/medium-chain fatty acid:CoA ligase from human liver mitochondria.", "journal": "Journal of biochemical and molecular toxicology", "date": "2003", "authors": "Vessey DA, Lau E, Kelley M, Warren RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "12616642", "url": "https://glygen.org/publication/PubMed/12616642" } ] }, { "title": "Efficient inhibition of P-glycoprotein-mediated multidrug resistance with a monoclonal antibody.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Mechetner EB, Roninson IB", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "1352877", "url": "https://glygen.org/publication/PubMed/1352877" } ] }, { "title": "Partial purification and reconstitution of the human multidrug-resistance pump: characterization of the drug-stimulatable ATP hydrolysis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Ambudkar SV, Lelong IH, Zhang J, Cardarelli CO, Gottesman MM, Pastan I", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "1356264", "url": "https://glygen.org/publication/PubMed/1356264" } ] }, { "title": "P-glycoprotein but not topoisomerase II and glutathione-S-transferase-pi accounts for enhanced intracellular drug-resistance in LoVo MDR human cell lines.", "journal": "Tumori", "date": "1992", "authors": "Boiocchi M, Tumiotto L, Giannini F, Viel A, Biscontin G, Sartor F, Toffoli G", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "1359686", "url": "https://glygen.org/publication/PubMed/1359686" } ] }, { "title": "Interaction of serum and sodium salicylate: changes during acute infection and its influence on pharmacological activity.", "journal": "Bulletin of the Johns Hopkins Hospital", "date": "1960", "authors": "REYNOLDS RC, CLUFF LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "13741103", "url": "https://glygen.org/publication/PubMed/13741103" } ] }, { "title": "Phosphorylation of the cystic fibrosis transmembrane conductance regulator.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Picciotto MR, Cohn JA, Bertuzzi G, Greengard P, Nairn AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "1377674", "url": "https://glygen.org/publication/PubMed/1377674" } ] }, { "title": "Structural determinants of P-glycoprotein-mediated transport of glucocorticoids.", "journal": "Pharmaceutical research", "date": "2003", "authors": "Yates CR, Chang C, Kearbey JD, Yasuda K, Schuetz EG, Miller DD, Dalton JT, Swaan PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "14661924", "url": "https://glygen.org/publication/PubMed/14661924" } ] }, { "title": "Characterization of oligomeric human half-ABC transporter ATP-binding cassette G2.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Xu J, Liu Y, Yang Y, Bates S, Zhang JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-189483", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483" } ], "reference": [ { "type": "PubMed", "id": "15001581", "url": "https://glygen.org/publication/PubMed/15001581" } ] }, { "title": "Pharmacokinetics of erythromycin in rabbit corneas after single-dose infusion: role of P-glycoprotein as a barrier to in vivo ocular drug absorption.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2004", "authors": "Dey S, Gunda S, Mitra AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "15175422", "url": "https://glygen.org/publication/PubMed/15175422" } ] }, { "title": "The human multidrug-resistance-associated protein MRP1 mediates ATP-dependent transport of unconjugated bilirubin.", "journal": "The Biochemical journal", "date": "2004", "authors": "Rigato I, Pascolo L, Fernetti C, Ostrow JD, Tiribelli C", "evidence": [ { "database": "Reactome", "id": "R-HSA-189483", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483" } ], "reference": [ { "type": "PubMed", "id": "15245331", "url": "https://glygen.org/publication/PubMed/15245331" } ] }, { "title": "Identification of budesonide and prednisone as substrates of the intestinal drug efflux pump P-glycoprotein.", "journal": "Inflammatory bowel diseases", "date": "2004", "authors": "Dilger K, Schwab M, Fromm MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "15472518", "url": "https://glygen.org/publication/PubMed/15472518" } ] }, { "title": "Interactions of human P-glycoprotein with simvastatin, simvastatin acid, and atorvastatin.", "journal": "Pharmaceutical research", "date": "2004", "authors": "Hochman JH, Pudvah N, Qiu J, Yamazaki M, Tang C, Lin JH, Prueksaritanont T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706" } ], "reference": [ { "type": "PubMed", "id": "15497697", "url": "https://glygen.org/publication/PubMed/15497697" } ] }, { "title": "Metabolic properties of the acid and lactone forms of HMG-CoA reductase inhibitors.", "journal": "Xenobiotica; the fate of foreign compounds in biological systems", "date": "2004", "authors": "Fujino H, Saito T, Tsunenari Y, Kojima J, Sakaeda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706" } ], "reference": [ { "type": "PubMed", "id": "15801541", "url": "https://glygen.org/publication/PubMed/15801541" } ] }, { "title": "Selective and ATP-dependent translocation of peptides by the homodimeric ATP binding cassette transporter TAP-like (ABCB9).", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Wolters JC, Abele R, Tampe R", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "15863492", "url": "https://glygen.org/publication/PubMed/15863492" } ] }, { "title": "ABCB5-mediated doxorubicin transport and chemoresistance in human malignant melanoma.", "journal": "Cancer research", "date": "2005", "authors": "Frank NY, Margaryan A, Huang Y, Schatton T, Waaga-Gasser AM, Gasser M, Sayegh MH, Sadee W, Frank MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "15899824", "url": "https://glygen.org/publication/PubMed/15899824" } ] }, { "title": "Glucuronidation of the aspirin metabolite salicylic acid by expressed UDP-glucuronosyltransferases and human liver microsomes.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2006", "authors": "Kuehl GE, Bigler J, Potter JD, Lampe JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "16258079", "url": "https://glygen.org/publication/PubMed/16258079" } ] }, { "title": "Transport by vesicles of glycine- and taurine-conjugated bile salts and taurolithocholate 3-sulfate: a comparison of human BSEP with rat Bsep.", "journal": "Biochim. Biophys. Acta", "date": "2005", "authors": "Hayashi H., Sugiyama Y., Suzuki H., Takada T., Hofmann A.F., Onuki R.", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "reference": [ { "type": "PubMed", "id": "16332456", "url": "https://glygen.org/publication/PubMed/16332456" } ] }, { "title": "Kinetics of acetaminophen glucuronidation by UDP-glucuronosyltransferases 1A1, 1A6, 1A9 and 2B15. Potential implications in acetaminophen-induced hepatotoxicity.", "journal": "Chemical research in toxicology", "date": "2006", "authors": "Mutlib AE, Goosen TC, Bauman JN, Williams JA, Kulkarni S, Kostrubsky S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "16696573", "url": "https://glygen.org/publication/PubMed/16696573" } ] }, { "title": "Transmembrane transport of endo- and xenobiotics by mammalian ATP-binding cassette multidrug resistance proteins.", "journal": "Physiological reviews", "date": "2006", "authors": "Deeley RG, Westlake C, Cole SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "16816140", "url": "https://glygen.org/publication/PubMed/16816140" } ] }, { "title": "Substrate specificity of carboxylesterase isozymes and their contribution to hydrolase activity in human liver and small intestine.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2006", "authors": "Imai T, Taketani M, Shii M, Hosokawa M, Chiba K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "16837570", "url": "https://glygen.org/publication/PubMed/16837570" } ] }, { "title": "Human carboxylesterase isozymes: catalytic properties and rational drug design.", "journal": "Drug metabolism and pharmacokinetics", "date": "2006", "authors": "Imai T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "16858120", "url": "https://glygen.org/publication/PubMed/16858120" } ] }, { "title": "Sequential quality-control checkpoints triage misfolded cystic fibrosis transmembrane conductance regulator.", "journal": "Cell", "date": "2006", "authors": "Younger JM, Chen L, Ren HY, Rosser MF, Turnbull EL, Fan CY, Patterson C, Cyr DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "16901789", "url": "https://glygen.org/publication/PubMed/16901789" } ] }, { "title": "Antiplatelet agents aspirin and clopidogrel are hydrolyzed by distinct carboxylesterases, and clopidogrel is transesterificated in the presence of ethyl alcohol.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2006", "authors": "Tang M, Mukundan M, Yang J, Charpentier N, LeCluyse EL, Black C, Yang D, Shi D, Yan B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "16943252", "url": "https://glygen.org/publication/PubMed/16943252" } ] }, { "title": "Molecular mechanism of phase I and phase II drug-metabolizing enzymes: implications for detoxification.", "journal": "International review of cytology", "date": "2007", "authors": "Iyanagi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "17482904", "url": "https://glygen.org/publication/PubMed/17482904" } ] }, { "title": "Bile salt-dependent efflux of cellular phospholipids mediated by ATP binding cassette protein B4.", "journal": "Hepatology (Baltimore, Md.)", "date": "2007", "authors": "Morita SY, Kobayashi A, Takanezawa Y, Kioka N, Handa T, Arai H, Matsuo M, Ueda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "17523162", "url": "https://glygen.org/publication/PubMed/17523162" } ] }, { "title": "Induction of hepatobiliary efflux transporters in acetaminophen-induced acute liver failure cases.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2007", "authors": "Barnes SN, Aleksunes LM, Augustine L, Scheffer GL, Goedken MJ, Jakowski AB, Pruimboom-Brees IM, Cherrington NJ, Manautou JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "17627974", "url": "https://glygen.org/publication/PubMed/17627974" } ] }, { "title": "Model representation of salicylate pharmacokinetics using unbound plasma salicylate concentrations and metabolite urinary excretion rates following a single oral dose.", "journal": "Journal of pharmacokinetics and biopharmaceutics", "date": "1991", "authors": "Shen J, Wanwimolruk S, Purves RD, McQueen EG, Roberts MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "1783992", "url": "https://glygen.org/publication/PubMed/1783992" } ] }, { "title": "A mutation in the ATP-binding site of the Kir6.2 subunit of the KATP channel alters coupling with the SUR2A subunit.", "journal": "The Journal of physiology", "date": "2007", "authors": "Tammaro P, Ashcroft FM", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "17855752", "url": "https://glygen.org/publication/PubMed/17855752" } ] }, { "title": "The N-terminal region of ABC50 interacts with eukaryotic initiation factor eIF2 and is a target for regulatory phosphorylation by CK2.", "journal": "The Biochemical journal", "date": "2008", "authors": "Paytubi S, Morrice NA, Boudeau J, Proud CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "17894550", "url": "https://glygen.org/publication/PubMed/17894550" } ] }, { "title": "Kinetic characterization and identification of the acylation and glycosylation sites of recombinant human gamma-glutamyltranspeptidase.", "journal": "Biochemistry", "date": "2007", "authors": "Castonguay R, Halim D, Morin M, Furtos A, Lherbet C, Bonneil E, Thibault P, Keillor JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "17924658", "url": "https://glygen.org/publication/PubMed/17924658" } ] }, { "title": "Identification of a lysosomal peptide transport system induced during dendritic cell development.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Demirel O, Waibler Z, Kalinke U, Grunebach F, Appel S, Brossart P, Hasilik A, Tampe R, Abele R", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "17977821", "url": "https://glygen.org/publication/PubMed/17977821" } ] }, { "title": "Interindividual variability in acetaminophen sulfation by human fetal liver: implications for pharmacogenetic investigations of drug-induced birth defects.", "journal": "Birth defects research. Part A, Clinical and molecular teratology", "date": "2008", "authors": "Adjei AA, Gaedigk A, Simon SD, Weinshilboum RM, Leeder JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "18232020", "url": "https://glygen.org/publication/PubMed/18232020" } ] }, { "title": "Inhibition of MDR1 expression by retinol treatment increases sensitivity to etoposide (VP16) in human neoplasic cell line.", "journal": "Toxicology in vitro : an international journal published in association with BIBRA", "date": "2008", "authors": "Klamt F, Passos DT, Castro MA, Gelain DP, Grivicich I, Moreira JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "18282684", "url": "https://glygen.org/publication/PubMed/18282684" } ] }, { "title": "The human gamma-glutamyltransferase gene family.", "journal": "Human genetics", "date": "2008", "authors": "Heisterkamp N, Groffen J, Warburton D, Sneddon TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "18357469", "url": "https://glygen.org/publication/PubMed/18357469" } ] }, { "title": "Peptide specificity and lipid activation of the lysosomal transport complex ABCB9 (TAPL).", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Zhao C, Haase W, Tampe R, Abele R", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "18434309", "url": "https://glygen.org/publication/PubMed/18434309" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" }, { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Mol. Cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" }, { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Contribution of cytochrome P450 3A4 and 3A5 to the metabolism of atorvastatin.", "journal": "Xenobiotica; the fate of foreign compounds in biological systems", "date": "2008", "authors": "Park JE, Kim KB, Bae SK, Moon BS, Liu KH, Shin JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706" } ], "reference": [ { "type": "PubMed", "id": "18720283", "url": "https://glygen.org/publication/PubMed/18720283" } ] }, { "title": "One step at a time: endoplasmic reticulum-associated degradation.", "journal": "Nature reviews. Molecular cell biology", "date": "2008", "authors": "Vembar SS, Brodsky JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "19002207", "url": "https://glygen.org/publication/PubMed/19002207" } ] }, { "title": "Phosphoproteomic analysis of distinct tumor cell lines in response to nocodazole treatment.", "journal": "Proteomics", "date": "2009", "authors": "Nagano K, Shinkawa T, Mutoh H, Kondoh O, Morimoto S, Inomata N, Ashihara M, Ishii N, Aoki Y, Haramura M", "evidence": [ { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" } ], "reference": [ { "type": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" } ] }, { "title": "Influx and efflux transport as determinants of melphalan cytotoxicity: Resistance to melphalan in MDR1 overexpressing tumor cell lines.", "journal": "Biochemical pharmacology", "date": "2009", "authors": "Kuhne A, Tzvetkov MV, Hagos Y, Lage H, Burckhardt G, Brockmoller J", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "19447222", "url": "https://glygen.org/publication/PubMed/19447222" } ] }, { "title": "Human kidney gamma-glutamyl transpeptidase. Catalytic properties, subunit structure, and localization of the gamma-glutamyl binding site on the light subunit.", "journal": "The Journal of biological chemistry", "date": "1977", "authors": "Tate SS, Ross ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "19463", "url": "https://glygen.org/publication/PubMed/19463" } ] }, { "title": "ABC50 promotes translation initiation in mammalian cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Paytubi S, Wang X, Lam YW, Izquierdo L, Hunter MJ, Jan E, Hundal HS, Proud CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "19570978", "url": "https://glygen.org/publication/PubMed/19570978" } ] }, { "title": "Phosphoproteomic analysis of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Brill LM, Xiong W, Lee KB, Ficarro SB, Crain A, Xu Y, Terskikh A, Snyder EY, Ding S", "evidence": [ { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" } ], "reference": [ { "type": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ] }, { "title": "Multidrug resistance phenotype of human BRO melanoma cells transfected with a wild-type human mdr1 complementary DNA.", "journal": "Cancer research", "date": "1990", "authors": "Lincke CR, van der Bliek AM, Schuurhuis GJ, van der Velde-Koerts T, Smit JJ, Borst P", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "1968359", "url": "https://glygen.org/publication/PubMed/1968359" } ] }, { "title": "UDP-glucuronosyltransferase (UGT) polymorphisms affect atorvastatin lactonization in vitro and in vivo.", "journal": "Clinical pharmacology and therapeutics", "date": "2010", "authors": "Riedmaier S, Klein K, Hofmann U, Keskitalo JE, Neuvonen PJ, Schwab M, Niemi M, Zanger UM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706" } ], "reference": [ { "type": "PubMed", "id": "19794410", "url": "https://glygen.org/publication/PubMed/19794410" } ] }, { "title": "Reaction of human albumin with aspirin in vitro: mass spectrometric identification of acetylated lysines 199, 402, 519, and 545.", "journal": "Biochemical pharmacology", "date": "2010", "authors": "Liyasova MS, Schopfer LM, Lockridge O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "19836360", "url": "https://glygen.org/publication/PubMed/19836360" } ] }, { "title": "Isoform-selective inactivation of human arylamine N-acetyltransferases by reactive metabolites of carcinogenic arylamines.", "journal": "Chemical research in toxicology", "date": "2009", "authors": "Liu L, Wagner CR, Hanna PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "19842618", "url": "https://glygen.org/publication/PubMed/19842618" } ] }, { "title": "MDR1 polymorphism role in patients treated with cetuximab and irinotecan in irinotecan refractory colorectal cancer.", "journal": "Medical oncology (Northwood, London, England)", "date": "2010", "authors": "Paule B, Castagne V, Picard V, Saffroy R, Adam R, Guettier C, Farinotti R, Bonhomme-Faivre L", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "19862647", "url": "https://glygen.org/publication/PubMed/19862647" } ] }, { "title": "The 5'-untranslated region of multidrug resistance associated protein 2 (MRP2; ABCC2) regulates downstream open reading frame expression through translational regulation.", "journal": "Molecular pharmacology", "date": "2010", "authors": "Zhang Y, Zhao T, Li W, Vore M", "evidence": [ { "database": "RefSeq", "id": "NP_000383", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000383" } ], "reference": [ { "type": "PubMed", "id": "19890061", "url": "https://glygen.org/publication/PubMed/19890061" } ] }, { "title": "A mutation in the second nucleotide binding fold of the cystic fibrosis gene.", "journal": "American journal of human genetics", "date": "1991", "authors": "Osborne L, Knight R, Santis G, Hodson M", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "1998343", "url": "https://glygen.org/publication/PubMed/1998343" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "Membrane transporters in drug development.", "journal": "Nature reviews. Drug discovery", "date": "2010", "authors": "Giacomini KM, Huang SM, Tweedie DJ, Benet LZ, Brouwer KL, Chu X, Dahlin A, Evers R, Fischer V, Hillgren KM, Hoffmaster KA, Ishikawa T, Keppler D, Kim RB, Lee CA, Niemi M, Polli JW, Sugiyama Y, Swaan PW, Ware JA, Wright SH, Yee SW, Zamek-Gliszczynski MJ, Zhang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "20190787", "url": "https://glygen.org/publication/PubMed/20190787" } ] }, { "title": "P-glycoprotein, but not multidrug resistance protein 4, plays a role in the systemic clearance of irinotecan and SN-38 in mice.", "journal": "Drug metabolism letters", "date": "2010", "authors": "Tagen M, Zhuang Y, Zhang F, Harstead KE, Shen J, Schaiquevich P, Fraga CH, Panetta JC, Waters CM, Stewart CF", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "20583968", "url": "https://glygen.org/publication/PubMed/20583968" } ] }, { "title": "Differences in assessment of macrolide interaction with human MDR1 (ABCB1, P-gp) using rhodamine-123 efflux, ATPase activity and cellular accumulation assays.", "journal": "European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences", "date": "2010", "authors": "Munic V, Kelneric Z, Mikac L, Erakovic Haber V", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "20621639", "url": "https://glygen.org/publication/PubMed/20621639" } ] }, { "title": "Mutational analysis of ABCC2 gene in two siblings with neonatal-onset Dubin Johnson syndrome.", "journal": "Clinical genetics", "date": "2010", "authors": "Pacifico L, Carducci C, Poggiogalle E, Caravona F, Antonozzi I, Chiesa C, Maggiore G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5679001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5679001" } ], "reference": [ { "type": "PubMed", "id": "21044052", "url": "https://glygen.org/publication/PubMed/21044052" } ] }, { "title": "Identification of novel functional organic anion-transporting polypeptide 1B3 polymorphisms and assessment of substrate specificity.", "journal": "Pharmacogenetics and genomics", "date": "2011", "authors": "Schwarz UI, Meyer zu Schwabedissen HE, Tirona RG, Suzuki A, Leake BF, Mokrab Y, Mizuguchi K, Ho RH, Kim RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706" } ], "reference": [ { "type": "PubMed", "id": "21278621", "url": "https://glygen.org/publication/PubMed/21278621" } ] }, { "title": "UGT1A6 and UGT2B15 polymorphisms and acetaminophen conjugation in response to a randomized, controlled diet of select fruits and vegetables.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2011", "authors": "Navarro SL, Chen Y, Li L, Li SS, Chang JL, Schwarz Y, King IB, Potter JD, Bigler J, Lampe JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "21666065", "url": "https://glygen.org/publication/PubMed/21666065" } ] }, { "title": "Autocatalytic cleavage of human gamma-glutamyl transpeptidase is highly dependent on N-glycosylation at asparagine 95.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "West MB, Wickham S, Quinalty LM, Pavlovicz RE, Li C, Hanigan MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "21712391", "url": "https://glygen.org/publication/PubMed/21712391" } ] }, { "title": "Paraoxonase (PON1 and PON3) Polymorphisms: Impact on Liver Expression and Atorvastatin-Lactone Hydrolysis.", "journal": "Frontiers in pharmacology", "date": "2011", "authors": "Riedmaier S, Klein K, Winter S, Hofmann U, Schwab M, Zanger UM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706" } ], "reference": [ { "type": "PubMed", "id": "21852972", "url": "https://glygen.org/publication/PubMed/21852972" } ] }, { "title": "CFTR and TMEM16A are separate but functionally related Cl- channels.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "2011", "authors": "Ousingsawat J, Kongsuphol P, Schreiber R, Kunzelmann K", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "22178883", "url": "https://glygen.org/publication/PubMed/22178883" } ] }, { "title": "Complete OATP1B1 and OATP1B3 deficiency causes human Rotor syndrome by interrupting conjugated bilirubin reuptake into the liver.", "journal": "The Journal of clinical investigation", "date": "2012", "authors": "van de Steeg E, Stranecky V, Hartmannova H, Noskova L, Hrebicek M, Wagenaar E, van Esch A, de Waart DR, Oude Elferink RP, Kenworthy KE, Sticova E, al-Edreesi M, Knisely AS, Kmoch S, Jirsa M, Schinkel AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-189483", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483" } ], "reference": [ { "type": "PubMed", "id": "22232210", "url": "https://glygen.org/publication/PubMed/22232210" } ] }, { "title": "Functional characterization of protein variants of the human multidrug transporter ABCC2 by a novel targeted expression system in fibrosarcoma cells.", "journal": "Hum. Mutat.", "date": "2012", "authors": "Arlanov R, Porter A, Strand D, Brough R, Karpova D, Kerb R, Wojnowski L, Schwab M, Lang T", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "reference": [ { "type": "PubMed", "id": "22290738", "url": "https://glygen.org/publication/PubMed/22290738" } ] }, { "title": "Aminoacylase 1-catalysed deacetylation of bioactives epoxides mycotoxin-derived mercapturates; 3,4-epoxyprecocenes as models of cytotoxic epoxides.", "journal": "Biochimie", "date": "2012", "authors": "Stocker P, Brunel JM, de Rezende L, do Amaral AT, Morelli X, Roche P, Vidal N, Giardina T, Perrier J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "22349737", "url": "https://glygen.org/publication/PubMed/22349737" } ] }, { "title": "Impact of probe compound in MRP2 vesicular transport assays.", "journal": "European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences", "date": "2012", "authors": "Kidron H, Wissel G, Manevski N, Hakli M, Ketola RA, Finel M, Yliperttula M, Xhaard H, Urtti A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "22406294", "url": "https://glygen.org/publication/PubMed/22406294" } ] }, { "title": "Biowaiver monograph for immediate-release solid oral dosage forms: acetylsalicylic acid.", "journal": "Journal of pharmaceutical sciences", "date": "2012", "authors": "Dressman JB, Nair A, Abrahamsson B, Barends DM, Groot DW, Kopp S, Langguth P, Polli JE, Shah VP, Zimmer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "22674043", "url": "https://glygen.org/publication/PubMed/22674043" } ] }, { "title": "Molecular modeling to provide insight into the substrate binding and catalytic mechanism of human biliverdin-IXalpha reductase.", "journal": "The journal of physical chemistry. B", "date": "2012", "authors": "Fu G, Liu H, Doerksen RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-189483", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483" } ], "reference": [ { "type": "PubMed", "id": "22823425", "url": "https://glygen.org/publication/PubMed/22823425" } ] }, { "title": "Characterisation of the roles of ABCB1, ABCC1, ABCC2 and ABCG2 in the transport and pharmacokinetics of actinomycin D in vitro and in vivo.", "journal": "Biochemical pharmacology", "date": "2013", "authors": "Hill CR, Jamieson D, Thomas HD, Brown CD, Boddy AV, Veal GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "23063411", "url": "https://glygen.org/publication/PubMed/23063411" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" }, { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Transport function and transcriptional regulation of a liver-enriched human organic anion transporting polypeptide 2B1 transcriptional start site variant.", "journal": "Molecular pharmacology", "date": "2013", "authors": "Knauer MJ, Girdwood AJ, Kim RB, Tirona RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706" } ], "reference": [ { "type": "PubMed", "id": "23531488", "url": "https://glygen.org/publication/PubMed/23531488" } ] }, { "title": "ATP-dependent transport of statins by human and rat MRP2/Mrp2.", "journal": "Toxicology and applied pharmacology", "date": "2013", "authors": "Ellis LC, Hawksworth GM, Weaver RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706" } ], "reference": [ { "type": "PubMed", "id": "23562342", "url": "https://glygen.org/publication/PubMed/23562342" } ] }, { "title": "Human GGT2 does not autocleave into a functional enzyme: A cautionary tale for interpretation of microarray data on redox signaling.", "journal": "Antioxidants & redox signaling", "date": "2013", "authors": "West MB, Wickham S, Parks EE, Sherry DM, Hanigan MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "23682772", "url": "https://glygen.org/publication/PubMed/23682772" } ] }, { "title": "RNF185 is a novel E3 ligase of endoplasmic reticulum-associated degradation (ERAD) that targets cystic fibrosis transmembrane conductance regulator (CFTR).", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "El Khouri E, Le Pavec G, Toledano MB, Delaunay-Moisan A", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "24019521", "url": "https://glygen.org/publication/PubMed/24019521" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" }, { "database": "iPTMnet", "id": "Q92887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92887" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Biosynthesis of cystic fibrosis transmembrane conductance regulator.", "journal": "The international journal of biochemistry & cell biology", "date": "2014", "authors": "Pranke IM, Sermet-Gaudelus I", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "24685677", "url": "https://glygen.org/publication/PubMed/24685677" } ] }, { "title": "Identification of the cystic fibrosis gene: cloning and characterization of complementary DNA.", "journal": "Science (New York, N.Y.)", "date": "1989", "authors": "Riordan JR, Rommens JM, Kerem B, Alon N, Rozmahel R, Grzelczak Z, Zielenski J, Lok S, Plavsic N, Chou JL, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "2475911", "url": "https://glygen.org/publication/PubMed/2475911" } ] }, { "title": "Hepatic uptake of atorvastatin: influence of variability in transporter expression on uptake clearance and drug-drug interactions.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2014", "authors": "Vildhede A, Karlgren M, Svedberg EK, Wisniewski JR, Lai Y, Noren A, Artursson P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706" } ], "reference": [ { "type": "PubMed", "id": "24799396", "url": "https://glygen.org/publication/PubMed/24799396" } ] }, { "title": "Molecular mechanisms for biliary phospholipid and drug efflux mediated by ABCB4 and bile salts.", "journal": "BioMed research international", "date": "2014", "authors": "Morita SY, Terada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "25133187", "url": "https://glygen.org/publication/PubMed/25133187" } ] }, { "title": "Neonatal Dubin-Johnson syndrome: novel compound heterozygous mutation in the ABCC2 gene.", "journal": "Pediatr. Int.", "date": "2014", "authors": "Okada H, Kusaka T, Fuke N, Kunikata J, Kondo S, Iwase T, Nan W, Hirota T, Ieiri I, Itoh S", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "reference": [ { "type": "PubMed", "id": "25336012", "url": "https://glygen.org/publication/PubMed/25336012" } ] }, { "title": "Transepithelial transport of drugs by the multidrug transporter in cultured Madin-Darby canine kidney cell epithelia.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Horio M, Chin KV, Currier SJ, Goldenberg S, Williams C, Pastan I, Gottesman MM, Handler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "2570070", "url": "https://glygen.org/publication/PubMed/2570070" } ] }, { "title": "Different gamma-glutamyl transpeptidase mRNAs are expressed in human liver and kidney.", "journal": "Biochemical and biophysical research communications", "date": "1989", "authors": "Pawlak A, Wu SJ, Bulle F, Suzuki A, Chikhi N, Ferry N, Baik JH, Siegrist S, Guellaen G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "2573352", "url": "https://glygen.org/publication/PubMed/2573352" } ] }, { "title": "Aromatic hydroxylation of salicylic acid and aspirin by human cytochromes P450.", "journal": "European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences", "date": "2015", "authors": "Bojic M, Sedgeman CA, Nagy LD, Guengerich FP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "25840124", "url": "https://glygen.org/publication/PubMed/25840124" } ] }, { "title": "PharmGKB summary: pathways of acetaminophen metabolism at the therapeutic versus toxic doses.", "journal": "Pharmacogenetics and genomics", "date": "2015", "authors": "Mazaleuskaya LL, Sangkuhl K, Thorn CF, FitzGerald GA, Altman RB, Klein TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "26049587", "url": "https://glygen.org/publication/PubMed/26049587" } ] }, { "title": "Sulphation of acetaminophen by the human cytosolic sulfotransferases: a systematic analysis.", "journal": "Journal of biochemistry", "date": "2015", "authors": "Yamamoto A, Liu MY, Kurogi K, Sakakibara Y, Saeki Y, Suiko M, Liu MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "26067475", "url": "https://glygen.org/publication/PubMed/26067475" } ] }, { "title": "Temozolomide competes for P-glycoprotein and contributes to chemoresistance in glioblastoma cells.", "journal": "Cancer letters", "date": "2015", "authors": "Munoz JL, Walker ND, Scotto KW, Rameshwar P", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "26208431", "url": "https://glygen.org/publication/PubMed/26208431" } ] }, { "title": "Statin Lactonization by Uridine 5'-Diphospho-glucuronosyltransferases (UGTs).", "journal": "Molecular pharmaceutics", "date": "2015", "authors": "Schirris TJ, Ritschel T, Bilos A, Smeitink JA, Russel FG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706" } ], "reference": [ { "type": "PubMed", "id": "26412035", "url": "https://glygen.org/publication/PubMed/26412035" } ] }, { "title": "Polymorphisms in the multidrug-resistance 1 gene related to glucocorticoid response in rheumatoid arthritis treatment.", "journal": "Rheumatology international", "date": "2017", "authors": "Cuppen BV, Pardali K, Kraan MC, Marijnissen AC, Yrlid L, Olsson M, Bijlsma JW, Lafeber FP, Fritsch-Stork RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "28132103", "url": "https://glygen.org/publication/PubMed/28132103" } ] }, { "title": "The Organic Anion-Transporting Peptide 2B1 Is Localized in the Basolateral Membrane of the Human Jejunum and Caco-2 Monolayers.", "journal": "J. Pharm. Sci.", "date": "2017", "authors": "Mueller J., Keiser M., Grube M., Heidecke C.D., Kaltheuner L., Oswald S., Partecke L.I., Wildberg C.", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "reference": [ { "type": "PubMed", "id": "28408210", "url": "https://glygen.org/publication/PubMed/28408210" } ] }, { "title": "Carboxylesterases in lipid metabolism: from mouse to human.", "journal": "Protein & cell", "date": "2018", "authors": "Lian J, Nelson R, Lehner R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "28677105", "url": "https://glygen.org/publication/PubMed/28677105" } ] }, { "title": "A retrovirus carrying an MDR1 cDNA confers multidrug resistance and polarized expression of P-glycoprotein in MDCK cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1988", "authors": "Pastan I, Gottesman MM, Ueda K, Lovelace E, Rutherford AV, Willingham MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "2898143", "url": "https://glygen.org/publication/PubMed/2898143" } ] }, { "title": "Human multidrug resistance protein 4 (MRP4) is a cellular efflux transporter for paracetamol glutathione and cysteine conjugates.", "journal": "Archives of toxicology", "date": "2020", "authors": "Koenderink JB, van den Heuvel JJMW, Bilos A, Vredenburg G, Vermeulen NPE, Russel FGM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "32472168", "url": "https://glygen.org/publication/PubMed/32472168" } ] }, { "title": "Is the emperor wearing shorts? The published structures of ABC transporters.", "journal": "FEBS letters", "date": "2020", "authors": "Jones PM, George AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "32981041", "url": "https://glygen.org/publication/PubMed/32981041" } ] }, { "title": "2,3-Dihydroxybenzoic acid is a product of human aspirin metabolism.", "journal": "Biochemical pharmacology", "date": "1988", "authors": "Grootveld M, Halliwell B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "3342084", "url": "https://glygen.org/publication/PubMed/3342084" } ] }, { "title": "The spontaneous and enzymatic reaction of N-acetyl-p-benzoquinonimine with glutathione: a stopped-flow kinetic study.", "journal": "Archives of biochemistry and biophysics", "date": "1988", "authors": "Coles B, Wilson I, Wardman P, Hinson JA, Nelson SD, Ketterer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "3395122", "url": "https://glygen.org/publication/PubMed/3395122" } ] }, { "title": "Comparative Hepatic and Intestinal Metabolism and Pharmacodynamics of Statins.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2021", "authors": "Filppula AM, Hirvensalo P, Parviainen H, Ivaska VE, Lonnberg KI, Deng F, Viinamaki J, Kurkela M, Neuvonen M, Niemi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706" } ], "reference": [ { "type": "PubMed", "id": "34045219", "url": "https://glygen.org/publication/PubMed/34045219" } ] }, { "title": "Human multidrug-resistant cell lines: increased mdr1 expression can precede gene amplification.", "journal": "Science (New York, N.Y.)", "date": "1986", "authors": "Shen DW, Fojo A, Chin JE, Roninson IB, Richert N, Pastan I, Gottesman MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "3457471", "url": "https://glygen.org/publication/PubMed/3457471" } ] }, { "title": "Expression of a full-length cDNA for the human `MDR1` gene confers resistance to colchicine, doxorubicin, and vinblastine.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1987", "authors": "Ueda K, Cardarelli C, Gottesman MM, Pastan I", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "3472246", "url": "https://glygen.org/publication/PubMed/3472246" } ] }, { "title": "Concurrence of novel mutations causing Gilbert's and Dubin-Johnson syndrome with poor clinical outcomes in a Han Chinese family.", "journal": "Journal of human genetics", "date": "2022-10-24", "authors": "Zhou Tai-Cheng, Li Xiao, Li Hui, Liu Feng-Wei, Zhang Si-Hang, Fan Jing-Hua, Yang Wen-Xiu, Yang Ya-Li, Zhang Liang, Wei Jia", "evidence": [ { "database": "RefSeq", "id": "NP_000383", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000383" } ], "reference": [ { "type": "PubMed", "id": "36274106", "url": "https://glygen.org/publication/PubMed/36274106" } ] }, { "title": "Effects of splicing-regulatory polymorphisms in ABCC2, ABCG2, and ABCB1 on methotrexate exposure in Chinese children with acute lymphoblastic leukemia.", "journal": "Cancer chemotherapy and pharmacology", "date": "2022-12-04", "authors": "Li Miao, Kong Xiao-Yan, Wang Shu-Mei", "evidence": [ { "database": "RefSeq", "id": "NP_000383", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000383" } ], "reference": [ { "type": "PubMed", "id": "36463535", "url": "https://glygen.org/publication/PubMed/36463535" } ] }, { "title": "Genetic variations in ABC transporter genes as a predictive biomarker for toxicity in North Indian lung cancer patients undergoing platinum-based doublet chemotherapy.", "journal": "Journal of biochemical and molecular toxicology", "date": "2022-12-11", "authors": "Sharma Parul, Singh Navneet, Sharma Siddharth", "evidence": [ { "database": "RefSeq", "id": "NP_000383", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000383" } ], "reference": [ { "type": "PubMed", "id": "36507589", "url": "https://glygen.org/publication/PubMed/36507589" } ] }, { "title": "Association between ABCG2, ABCB1, ABCC2 efflux transporters SNP's and irinotecan adverse effects in colorectal cancer patients: a real life study.", "journal": "Clinical pharmacology and therapeutics", "date": "2022-12-20", "authors": "Barnett-Griness Ofra, Rennert Gad, Lejbkowicz Flavio, Pinchev Mila, Saliba Walid, Gronich Naomi", "evidence": [ { "database": "RefSeq", "id": "NP_000383", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000383" } ], "reference": [ { "type": "PubMed", "id": "36537755", "url": "https://glygen.org/publication/PubMed/36537755" } ] }, { "title": "The metabolism of aspirin in man: a population study.", "journal": "Xenobiotica; the fate of foreign compounds in biological systems", "date": "1986", "authors": "Hutt AJ, Caldwell J, Smith RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "3705620", "url": "https://glygen.org/publication/PubMed/3705620" } ] }, { "title": "Two hepatic cytoplasmic protein fractions, Y and Z, and their possible role in the hepatic uptake of bilirubin, sulfobromophthalein, and other anions.", "journal": "The Journal of clinical investigation", "date": "1969", "authors": "Levi AJ, Gatmaitan Z, Arias IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-189483", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483" } ], "reference": [ { "type": "PubMed", "id": "4980931", "url": "https://glygen.org/publication/PubMed/4980931" } ] }, { "title": "Absorption kinetics of aspirin in man following oral administration of an aqueous solution.", "journal": "Journal of pharmaceutical sciences", "date": "1972", "authors": "Rowland M, Riegelman S, Harris PA, Sholkoff SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "5013373", "url": "https://glygen.org/publication/PubMed/5013373" } ] }, { "title": "Structural changes in human serum albumin induced by ingestion of acetylsalicylic acid.", "journal": "The Journal of clinical investigation", "date": "1969", "authors": "Hawkins D, Pinckard RN, Crawford IP, Farr RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "5773090", "url": "https://glygen.org/publication/PubMed/5773090" } ] }, { "title": "Pharmacokinetics of salicylate elimination in man.", "journal": "Journal of pharmaceutical sciences", "date": "1965", "authors": "Levy G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "5862532", "url": "https://glygen.org/publication/PubMed/5862532" } ] }, { "title": "Difference in hepatic uptake kinetics of aspirin and salicylamide in rats.", "journal": "Biochemical pharmacology", "date": "1984", "authors": "Iwamoto K, Furune Y, Watanabe J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "6487359", "url": "https://glygen.org/publication/PubMed/6487359" } ] }, { "title": "Plasma aspirin esterases in normal individuals, patients with alcoholic liver disease and rheumatoid arthritis: characterization and the importance of the enzymic components.", "journal": "European journal of clinical investigation", "date": "1980", "authors": "Rainsford KD, Ford NL, Brooks PM, Watson HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "6777177", "url": "https://glygen.org/publication/PubMed/6777177" } ] }, { "title": "Identification and partial purification of the major aspirin hydrolyzing enzyme in human blood.", "journal": "Arthritis and rheumatism", "date": "1983", "authors": "Costello PB, Green FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "6838677", "url": "https://glygen.org/publication/PubMed/6838677" } ] }, { "title": "Acetaminophen and phenol: substrates for both a thermostable and a thermolabile form of human platelet phenol sulfotransferase.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1982", "authors": "Reiter C, Weinshilboum RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "6950087", "url": "https://glygen.org/publication/PubMed/6950087" } ] }, { "title": "Treatment of paracetamol (acetaminophen) poisoning with N-acetylcysteine.", "journal": "Lancet (London, England)", "date": "1977", "authors": "Prescott LF, Park J, Ballantyne A, Adriaenssens P, Proudfoot AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "70646", "url": "https://glygen.org/publication/PubMed/70646" } ] }, { "title": "Comparative study of human intestinal and hepatic esterases as related to enzymatic properties and hydrolizing activity for ester-type drugs.", "journal": "Japanese journal of pharmacology", "date": "1980", "authors": "Inoue M, Morikawa M, Tsuboi M, Ito Y, Sugiura M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "7206363", "url": "https://glygen.org/publication/PubMed/7206363" } ] }, { "title": "Bilirubin binding to human liver ligandin (glutathione S-transferase).", "journal": "The Journal of biological chemistry", "date": "1980", "authors": "Simons PC, Jagt DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-189483", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483" } ], "reference": [ { "type": "PubMed", "id": "7372607", "url": "https://glygen.org/publication/PubMed/7372607" } ] }, { "title": "Treatment of severe acetaminophen poisoning with intravenous acetylcysteine.", "journal": "Archives of internal medicine", "date": "1981", "authors": "Prescott LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "7469630", "url": "https://glygen.org/publication/PubMed/7469630" } ] }, { "title": "Intracellular turnover of cystic fibrosis transmembrane conductance regulator. Inefficient processing and rapid degradation of wild-type and mutant proteins.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Ward CL, Kopito RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "7523390", "url": "https://glygen.org/publication/PubMed/7523390" } ] }, { "title": "Conformational maturation of CFTR but not its mutant counterpart (delta F508) occurs in the endoplasmic reticulum and requires ATP.", "journal": "The EMBO journal", "date": "1994", "authors": "Lukacs GL, Mohamed A, Kartner N, Chang XB, Riordan JR, Grinstein S", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "7529176", "url": "https://glygen.org/publication/PubMed/7529176" } ] }, { "title": "Degradation of CFTR by the ubiquitin-proteasome pathway.", "journal": "Cell", "date": "1995", "authors": "Ward CL, Omura S, Kopito RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "7553863", "url": "https://glygen.org/publication/PubMed/7553863" } ] }, { "title": "Multiple proteolytic systems, including the proteasome, contribute to CFTR processing.", "journal": "Cell", "date": "1995", "authors": "Jensen TJ, Loo MA, Pind S, Williams DB, Goldberg AL, Riordan JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "7553864", "url": "https://glygen.org/publication/PubMed/7553864" } ] }, { "title": "Purification to homogeneity of mitochondrial acyl coa:glycine n-acyltransferase from human liver.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Mawal YR, Qureshi IA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "7802672", "url": "https://glygen.org/publication/PubMed/7802672" } ] }, { "title": "P-glycoprotein mediates profound resistance to bisantrene.", "journal": "Oncology research", "date": "1994", "authors": "Zhang XP, Ritke MK, Yalowich JC, Slovak ML, Ho JP, Collins KI, Annable T, Arceci RJ, Durr FE, Greenberger LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "7865904", "url": "https://glygen.org/publication/PubMed/7865904" } ] }, { "title": "cDNA cloning of the hepatocyte canalicular isoform of the multidrug resistance protein, cMrp, reveals a novel conjugate export pump deficient in hyperbilirubinemic mutant rats.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Buchler M, Konig J, Brom M, Kartenbeck J, Spring H, Horie T, Keppler D", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "reference": [ { "type": "PubMed", "id": "8662992", "url": "https://glygen.org/publication/PubMed/8662992" } ] }, { "title": "A human canalicular multispecific organic anion transporter (cMOAT) gene is overexpressed in cisplatin-resistant human cancer cell lines with decreased drug accumulation.", "journal": "Cancer Res.", "date": "1996", "authors": "Nakamura T., Okumura K., Akiyama S., Kohno K., Kuwano M., Wada M., Kawabe T., Taniguchi K., Kawakami M., Kagotani K.", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "reference": [ { "type": "PubMed", "id": "8797578", "url": "https://glygen.org/publication/PubMed/8797578" } ] }, { "title": "Immunohistochemical detection of gamma-glutamyl transpeptidase in normal human tissue.", "journal": "The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society", "date": "1996", "authors": "Hanigan MH, Frierson HF Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "8813074", "url": "https://glygen.org/publication/PubMed/8813074" } ] }, { "title": "Influence of polymorphic N-acetyltransferase phenotype on the inhibition and induction of acetaminophen bioactivation with long-term isoniazid.", "journal": "Clinical pharmacology and therapeutics", "date": "1997", "authors": "Chien JY, Peter RM, Nolan CM, Wartell C, Slattery JT, Nelson SD, Carithers RL Jr, Thummel KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "9024171", "url": "https://glygen.org/publication/PubMed/9024171" } ] }, { "title": "Hydrolysis and transfer reactions catalyzed by gamma-glutamyl transpeptidase; evidence for separate substrate sites and for high affinity of L-cystine.", "journal": "Biochemical and biophysical research communications", "date": "1976", "authors": "Thompson GA, Meister A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "9080", "url": "https://glygen.org/publication/PubMed/9080" } ] }, { "title": "Molecular cloning and characterization of a novel putative carboxylesterase, present in human intestine and liver.", "journal": "Biochemical and biophysical research communications", "date": "1997", "authors": "Schwer H, Langmann T, Daig R, Becker A, Aslanidis C, Schmitz G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "9144407", "url": "https://glygen.org/publication/PubMed/9144407" } ] }, { "title": "Identification of separate acyl- CoA:glycine and acyl-CoA:L-glutamine N-acyltransferase activities in mitochondrial fractions from liver of rhesus monkey and man.", "journal": "The Journal of biological chemistry", "date": "1976", "authors": "Webster LT, Siddiqui UA, Lucas SV, Strong JM, Mieyal JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "931988", "url": "https://glygen.org/publication/PubMed/931988" } ] }, { "title": "Human liver paraoxonase (PON1): subcellular distribution and characterization.", "journal": "Journal of biochemical and molecular toxicology", "date": "1998", "authors": "Gonzalvo MC, Gil F, Hernandez AF, Rodrigo L, Villanueva E, Pla A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706" } ], "reference": [ { "type": "PubMed", "id": "9414488", "url": "https://glygen.org/publication/PubMed/9414488" } ] }, { "title": "Mutations in the canalicular multispecific organic anion transporter (cMOAT) gene, a novel ABC transporter, in patients with hyperbilirubinemia II/Dubin-Johnson syndrome.", "journal": "Hum. Mol. Genet.", "date": "1998", "authors": "Wada M, Toh S, Taniguchi K, Nakamura T, Uchiumi T, Kohno K, Yoshida I, Kimura A, Sakisaka S, Adachi Y, Kuwano M", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" }, { "database": "Reactome", "id": "R-HSA-5679001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5679001" } ], "reference": [ { "type": "PubMed", "id": "9425227", "url": "https://glygen.org/publication/PubMed/9425227" } ] }, { "title": "Identification of multispecific organic anion transporter 2 expressed predominantly in the liver.", "journal": "FEBS letters", "date": "1998", "authors": "Sekine T, Cha SH, Tsuda M, Apiwattanakul N, Nakajima N, Kanai Y, Endou H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "9650585", "url": "https://glygen.org/publication/PubMed/9650585" } ] }, { "title": "Stoichiometry of coupling of rhodamine 123 transport to ATP hydrolysis by P-glycoprotein.", "journal": "European journal of biochemistry", "date": "1998", "authors": "Shapiro AB, Ling V", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "9652413", "url": "https://glygen.org/publication/PubMed/9652413" } ] }, { "title": "Protein binding of salicylate in uremic and normal plasma.", "journal": "Clinical pharmacology and therapeutics", "date": "1976", "authors": "Borga O, Cederlof IO, Ringberger VA, Norlin A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "975718", "url": "https://glygen.org/publication/PubMed/975718" } ] }, { "title": "Retroviral transfer of the human MDR1 gene confers resistance to bisantrene-specific hematotoxicity.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "1996", "authors": "Aksentijevich I, Cardarelli CO, Pastan I, Gottesman MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "9816258", "url": "https://glygen.org/publication/PubMed/9816258" } ] }, { "title": "Reconstituted human cardiac KATP channels: functional identity with the native channels from the sarcolemma of human ventricular cells.", "journal": "Circulation research", "date": "1998", "authors": "Babenko AP, Gonzalez G, Aguilar-Bryan L, Bryan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "9831708", "url": "https://glygen.org/publication/PubMed/9831708" } ] } ], "pathway": [ { "id": "hsa:1244", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1244", "resource": "KEGG Pathway" }, { "id": "R-HSA-189483", "name": "Heme degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483", "resource": "Reactome", "description": "Heme degradation" }, { "id": "R-HSA-382556", "name": "ABC-family proteins mediated transport", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556", "resource": "Reactome", "description": "ABC-family proteins mediated transport" }, { "id": "R-HSA-5679001", "name": "Defective ABCC2 causes DJS", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5679001", "resource": "Reactome", "description": "Defective ABCC2 causes DJS" }, { "id": "R-HSA-9749641", "name": "Aspirin ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641", "resource": "Reactome", "description": "Aspirin ADME" }, { "id": "R-HSA-9753281", "name": "Paracetamol ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281", "resource": "Reactome", "description": "Paracetamol ADME" }, { "id": "R-HSA-9754706", "name": "Atorvastatin ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706", "resource": "Reactome", "description": "Atorvastatin ADME" } ], "orthologs": [ { "uniprot_canonical_ac": "Q63120-1", "protein_name": "ATP-binding cassette sub-family C member 2", "gene_name": "Abcc2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDKFCNSTFWDLSLLESPEADLPLCFEQTVLVWIPLGFLWLLAPWQLYSVYRSRTKRSSITKFYLAKQVFVVFLLILAAIDLSLALTEDTGQATVPPVRYTNPILYLCTWLLVLAVQHSRQWCVRKNSWFLSLFWILSVLCGVFQFQTLIRALLKDSKSNMAYSYLFFVSYGFQIVLLILTAFSGPSDSTQTPSVTASFLSSITFSWYDRTVLKGYKHPLTLEDVWDIDEGFKTRSVTSKFEAAMTKDLQKARQAFQRRLQKSQRKPEATLHGLNKKQSQSQDVLVLEEAKKKSEKTTKDYPKSWLIKSLFKTFHVVILKSFILKLIHDLLVFLNPQLLKLLIGFVKSSNSYVWFGYICAILMFAVTLIQSFCLQSYFQHCFVLGMCVRTTVMSSIYKKALTLSNLARKQYTIGETVNLMSVDSQKLMDATNYMQLVWSSVIQITLSIFFLWRELGPSILAGVGVMVLLIPVNGVLATKIRNIQVQNMKNKDKRLKIMNEILSGIKILKYFAWEPSFQEQVQGIRKKELKNLLRFGQLQSLLIFILQITPILVSVVTFSVYVLVDSANVLNAEKAFTSITLFNILRFPLSMLPMVTSSILQASVSVDRLERYLGGDDLDTSAIRRVSNFDKAVKFSEASFTWDPDLEATIQDVNLDIKPGQLVAVVGTVGSGKSSLVSAMLGEMENVHGHITIQGSTAYVPQQSWIQNGTIKDNILFGSEYNEKKYQQVLKACALLPDLEILPGGDMAEIGEKGINLSGGQKQRVSLARAAYQDADIYILDDPLSAVDAHVGKHIFNKVVGPNGLLAGKTRIFVTHGIHFLPQVDEIVVLGKGTILEKGSYRDLLDKKGVFARNWKTFMKHSGPEGEATVNNDSEAEDDDDGLIPTMEEIPEDAASLAMRRENSLRRTLSRSSRSSSRRGKSLKNSLKIKNVNVLKEKEKEVEGQKLIKKEFVETGKVKFSIYLKYLQAVGWWSILFIILFYGLNNVAFIGSNLWLSAWTSDSDNLNGTNNSSSHRDMRIGVFGALGLAQGICLLISTLWSIYACRNASKALHGQLLTNILRAPMRFFDTTPTGRIVNRFSGDISTVDDLLPQTLRSWMMCFFGIAGTLVMICMATPVFAIIIIPLSILYISVQVFYVATSRQLRRLDSVTKSPIYSHFSETVTGLPIIRAFEHQQRFLAWNEKQIDINQKCVFSWITSNRWLAIRLELVGNLVVFCSALLLVIYRKTLTGDVVGFVLSNALNITQTLNWLVRMTSEAETNIVAVERISEYINVENEAPWVTDKRPPADWPRHGEIQFNNYQVRYRPELDLVLKGITCNIKSGEKVGVVGRTGAGKSSLTNCLFRILESAGGQIIIDGIDVASIGLHDLRERLTIIPQDPILFSGSLRMNLDPFNKYSDEEVWRALELAHLRSFVSGLQLGLLSEVTEGGDNLSIGQRQLLCLGRAVLRKSKILVLDEATAAVDLETDSLIQTTIRKEFSQCTVITIAHRLHTIMDSDKIMVLDNGKIVEYGSPEELLSNRGSFYLMAKEAGIENVNHTEL", "length": 1541 }, "evidence": [ { "id": "45237080", "url": "http://www.informatics.jax.org/homology/45237080", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8VI47-1", "protein_name": "ATP-binding cassette sub-family C member 2", "gene_name": "Abcc2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDEFCNSTFWNLSLLKSPEADLPLCFEQTVLVWIPLGFLWLLAPWQLYRIYRSRTKRFAITKFYLAKQVFVVCLLILAAIDLSLALTEDTGQATIPPVKYTNPILYLCTWLLVLVIQHCRQCCIQKNSWFLSMFWILSLLCGIFQFQTLIRALLQDSKSNMTYSCLFFVSYGFQIVILILSAFSESSDSTHAPSATASFLSSVTFSWYDSTVLKGYKHPLTIEDVWDIEENLKAKSLTSKFKTIMTKDLQKARQALQRRLKKSQQSPEGTSHGLTKKQSQSQDVLVLEDSKKKKKKSEATKDFPKSWLVKALFKTFYVVILKSFILKLAHDILLFLNPQLLKFLIGFVKDPDSYPWVGYIYAILMFSVTLIQSFFLQCYFQFCFVLGMTVRTTIIASVYKKALTLSNLARRQYTIGETVNLMSVDSQKLMDVTNYIHLLWSSVLQIALSIFFLWRELGPSILAGVGLMVLLVPVNGVLATKIRKIQVQNMKNKDKRLKIMNEILSGIKILKYFAWEPSFKEQVNSIRKKELRNLLRFSQLQTILIFILHLTPTLVSVITFSVYVLVDSQNVLNAEKAFTSITLFNILRFPLAMLPMVISSVIQASVSVDRLEQYLGSDDLDLSAIRHVCHFDKAVQFSEASFTWDRDLEATIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIAYVPQQAWIQNGTIKDNILFGSEYDEKKYQRVIEACALLPDLEMLPGGDMAEIGEKGINLSGGQKHRVSLARATYQDADIYILDDPLSAVDTHVGKHIFNKVVGPNGLLSGKTRILVTHGIHFLPQVDEIVVLGKGTILEKGSYSDLMDKKGVFAKNWKTFMKHSGPEGEATVDNDSEEEDGDCGLIPTVEEIPDDAASLTMRRENSLRRTLSRSSRSGSRRGKSLKSSLKIKSVNALNKKEEVVKGQKLIKKEFVETGKVKFSIYLKYLQAVGWWSLLFIVIFYVLNYVAFIGTNLWLSAWTSDSEKQNGTDNSPSQRDMRIGVFGALGIAQGIFLLSSSLWSIYACRNASKTLHRQLLTNILRAPMSFFDTTPTGRIVNRFAGDISTVDDTLPQTLRSWLLCFFGIVSTLVMICMATPIFIIIIIPLSILYVSVQVFYVATSRQLRRLDSVTKSPIYSHFSETVSGLPVIRAFEHQQRFLANSEKQIDTNQKCVFSWITSNRWLAIRLELVGNLIVFCSALLLVIYKNSLTGDTVGFVLSNALNITQTLNWLVRMTSEVETNIVAVERINEYINVDNEAPWVTDKKPPADWPKKGEIQFNNYQVRYRPELDLVLKGITCNIKSTEKVGVVGRTGAGKSSLTNCLFRILESAGGQIIIDGIDIASIGLHDLRGRLTIIPQDPILFSGNLRMNLDPFNKYSDEEIWRALELAHLKSFVAGLQLGLLHEVTEGGDNLSIGQRQLLCLGRAVLRKSKILVLDEATAAVDLETDSLIQTTIRNEFSQCTVITIAHRLHTIMDSDKIMVLDSGKIVEYGSPEELLSNMGPFYLMAKEAGIESVNHTEL", "length": 1543 }, "evidence": [ { "id": "45237080", "url": "http://www.informatics.jax.org/homology/45237080", "database": "MGI" }, { "id": "Q92887", "url": "https://omabrowser.org/oma/group/Q92887/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "intercellular canaliculus", "id": "GO:0046581", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046581", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 10, "go_terms": [ { "name": "xenobiotic transmembrane transporter activity", "id": "GO:0042910", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042910", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "ATPase-coupled transmembrane transporter activity", "id": "GO:0042626", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042626", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "ABC-type xenobiotic transporter activity", "id": "GO:0008559", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008559", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "ATP hydrolysis activity", "id": "GO:0016887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016887", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "organic anion transmembrane transporter activity", "id": "GO:0008514", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008514", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "ATPase-coupled inorganic anion transmembrane transporter activity", "id": "GO:0043225", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043225", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "ABC-type glutathione S-conjugate transporter activity", "id": "GO:0015431", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015431", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "bilirubin transmembrane transporter activity", "id": "GO:0015127", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015127", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "ABC-type transporter activity", "id": "GO:0140359", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140359", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 12, "go_terms": [ { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "transmembrane transport", "id": "GO:0055085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055085", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "bile acid and bile salt transport", "id": "GO:0015721", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015721", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "xenobiotic metabolic process", "id": "GO:0006805", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006805", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "xenobiotic transmembrane transport", "id": "GO:0006855", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006855", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "heme catabolic process", "id": "GO:0042167", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042167", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "transepithelial transport", "id": "GO:0070633", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070633", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "xenobiotic export from cell", "id": "GO:0046618", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046618", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "xenobiotic transport across blood-brain barrier", "id": "GO:1990962", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990962", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "leukotriene transport", "id": "GO:0071716", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071716", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "transport across blood-brain barrier", "id": "GO:0150104", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0150104", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" }, { "name": "bilirubin transport", "id": "GO:0015723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015723", "evidence": [ { "database": "UniProtKB", "id": "Q92887", "url": "https://www.uniprot.org/uniprot/Q92887" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1011, "end_pos": 1013, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1216, "end_pos": 1218, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1247, "end_pos": 1249, "annotation": "n_glycosylation_sequon" }, { "start_pos": 12, "end_pos": 14, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1400, "end_pos": 1402, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1436, "end_pos": 1438, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1541, "end_pos": 1543, "annotation": "n_glycosylation_sequon" }, { "start_pos": 188, "end_pos": 190, "annotation": "n_glycosylation_sequon" }, { "start_pos": 279, "end_pos": 281, "annotation": "n_glycosylation_sequon" }, { "start_pos": 712, "end_pos": 714, "annotation": "n_glycosylation_sequon" }, { "start_pos": 760, "end_pos": 762, "annotation": "n_glycosylation_sequon" }, { "start_pos": 7, "end_pos": 9, "annotation": "n_glycosylation_sequon" }, { "start_pos": 836, "end_pos": 838, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "19121", "name": "", "equation": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8CG09-1", "O88563-1", "Q62796-1", "Q63120-1", "O88269-1", "F1M3J4-1", "P33527-1", "O15439-1", "O15438-1", "O95255-1", "Q5T3U5-1", "Q15311-1", "Q92887-1", "Q96J66-1", "Q9R1S7-1", "B2RX12-1", "O35379-1", "Q62172-1", "Q8R4P9-1", "Q8VI47-1", "E9Q236-1", "P39109-1", "P53049-1" ], "evidence": [ { "id": "19121", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/19121" } ] }, { "id": "38963", "name": "", "equation": "ATP + H2O + leukotriene C4(in) = ADP + H(+) + leukotriene C4(out) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q63120-1", "Q8CG09-1", "O88563-1", "Q62796-1", "O88269-1", "F1M3J4-1", "P33527-1", "Q92887-1", "O15439-1", "O15438-1", "O95255-1", "Q5T3U5-1", "Q15311-1", "Q96J66-1", "Q9R1S7-1", "B2RX12-1", "Q8VI47-1", "O35379-1", "Q62172-1", "Q8R4P9-1", "E9Q236-1" ], "evidence": [ { "id": "38963", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38963" } ] }, { "id": "50084", "name": "", "equation": "ATP + H2O + taurolithocholate 3-sulfate(in) = ADP + H(+) + phosphate + taurolithocholate 3-sulfate(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q63120-1", "O88563-1", "O95342-1", "Q92887-1", "O15438-1", "Q9QY30-1", "Q8VI47-1", "B2RX12-1" ], "evidence": [ { "id": "50084", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/50084" } ] }, { "id": "60128", "name": "", "equation": "17beta-estradiol 17-O-(beta-D-glucuronate)(in) + ATP + H2O = 17beta-estradiol 17-O-(beta-D-glucuronate)(out) + ADP + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q80W57-1", "Q63120-1", "Q8CG09-1", "O88563-1", "F1M3J4-1", "Q9UNQ0-1", "P33527-1", "Q92887-1", "O15439-1", "O15438-1", "Q5T3U5-1", "Q96J66-1", "Q7TMS5-1", "Q8VI47-1", "O35379-1", "Q8R4P9-1", "B2RX12-1", "E9Q236-1" ], "evidence": [ { "id": "60128", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/60128" } ] }, { "id": "66180", "name": "", "equation": "ATP + bilirubin-glucuronoside(in) + H2O = ADP + bilirubin-glucuronoside(out) + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q63120-1", "O88563-1", "O15438-1", "Q92887-1", "Q8VI47-1", "B2RX12-1" ], "evidence": [ { "id": "66180", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66180" } ] }, { "id": "66192", "name": "", "equation": "ATP + bilirubin-bisglucuronoside(in) + H2O = ADP + bilirubin-bisglucuronoside(out) + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q63120-1", "O88563-1", "O15438-1", "Q92887-1", "Q8VI47-1", "B2RX12-1" ], "evidence": [ { "id": "66192", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66192" } ] }, { "id": "R-HSA-1454916", "name": "The ABCC family mediates organic anion transport", "equation": "", "summary": "The multidrug resistance associated protein (MRPs) subfamily of the ABC transporter family can transport a wide and diverse range of organic anions that can be endogenous compounds and xenobiotics and their metabolites. All human MRPs (except MRP9) can mediate these transport reactions (Deeley et al. 2006). Separately, specific reactions have also been annotated to describe the roles of ABCC4 in platelet dense granule assembly, of ABCC1 in LTC4 export (an aspect of leukotriene synthesis), and of ABCC3 in bile salt efflux.", "cellular_location": "cytosol, extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-1454919" ], "enzyme_list": [ "Q96J66-1", "P13569-1", "O15440-1", "P33527-1", "Q5T3U5-1", "O15439-1", "O95255-1", "Q92887-1", "O15438-1" ], "evidence": [ { "id": "R-HSA-1454916", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1454916" } ] }, { "id": "R-HSA-5679031", "name": "Defective ABCC2 does not transport BMG,BDG from cytosol to extracellular region", "equation": "", "summary": "Canalicular multispecific organic anion transporter 1 (ABCC2 aka multidrug resistance-associated protein 2, MRP2), in addition to transporting many organic anions, mediates the ATP-dependent transport of glutathione and glucuronate conjugates from hepatocytes into bile. ABCC2 transports with high affinity and efficiency mono- and di-glucuronated bilirubin into bile. Bilirubin, the end product of heme breakdown, is an important constituent of bile and is responsible for its characteristic colour. Defects in ABCC2 can cause Dubin-Johnson syndrome (DJS; MIM:237500), an autosomal recessive disorder characterised by conjugated hyperbilirubinemia. Mutations causing DJS include I1173F, R1150H, R768W and R1066* (Mar-Cohen et al. 2001, Wada et al. 1998, Pacifico et al. 2010).", "cellular_location": "cytosol, extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q92887-1" ], "evidence": [ { "id": "R-HSA-5679031", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5679031" } ] }, { "id": "R-HSA-5679041", "name": "ABCC2 transports BMG,BDG from cytosol to extracellular region", "equation": "", "summary": "Canalicular multispecific organic anion transporter 1 (ABCC2 aka multidrug resistance-associated protein 2, MRP2), in addition to transporting many organic anions, mediates the ATP-dependent transport of glutathione and glucuronate conjugates from hepatocytes into bile. In the reaction annotated here, ABCC2 specifically transports, with high affinity and efficiency, mono- and di-glucuronated bilirubin (BMG, BDG respectively) into bile (Kamisako et al. 1999). ABCC2 is located on the canalicular membrane of hepatocytes. Bilirubin, the end product of heme breakdown, is an important constituent of bile and is responsible for its characteristic colour.", "cellular_location": "cytosol, extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q92887-1" ], "evidence": [ { "id": "R-HSA-5679041", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5679041" } ] }, { "id": "R-HSA-9750656", "name": "ABCC2, ABCC3 transport salicylate metabolites from cytosol to extracellular region of hepatic cells", "equation": "", "summary": "ATP-binding cassette sub-family C members 2 and 3 (ABCC2, ABCC3) transport glucuronides out of liver and kidney cells. They also are able to transport organic anions and amino acid conjugates (Cui et al, 1999; Zelcer et al, 2001; J\u00e4rvinen, 2019).", "cellular_location": "cytosol, extracellular region", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q92887-1", "O15438-1" ], "evidence": [ { "id": "R-HSA-9750656", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9750656" } ] }, { "id": "R-HSA-9753278", "name": "ABCC2,ABCG2 transport APAP-GlcA, APAP-SO3", "equation": "", "summary": "Excretion of glucuronidated acetaminophen (APAP-GlcA) and sulfated acetaminophen (APAP-SO3) into bile involves the ATP-binding cassette sub-family C member 2 transporter (ABCC2) and the broad substrate specificity ATP-binding cassette transporter (ABCG2), both found in the canalicular membrane of hepatocytes where they secrete drug conjugates into bile (Giacomini et al. 2010, Kidron et al. 2012, review McGill & Jaeschke 2013).", "cellular_location": "cytosol, extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9UNQ0-1", "Q92887-1" ], "evidence": [ { "id": "R-HSA-9753278", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753278" } ] }, { "id": "R-HSA-9757139", "name": "ABCB1,ABCC2 transport ATVs from cytosol to extracellular region", "equation": "", "summary": "ATP-binding cassette sub-family C member 2 (ABCC2, aka MRP2) (Ellis et al. 2013) and ATP-dependent translocase ABCB1 (ABCB1, aka P-glycoprotein 1) (Hochman et al. 2004) mediate the efflux of atorvastatin (ATV) and its lactone intermediates into bile.", "cellular_location": "cytosol, extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P08183-1", "Q92887-1" ], "evidence": [ { "id": "R-HSA-9757139", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757139" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-1454919", "participant_name": "organic anion [extracellular region]", "crossref": [ { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "B2RX12", "gene_name": "Abcc3", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "B2RX12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RX12" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "B2RX12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RX12" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "B2RX12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RX12" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "B2RX12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RX12" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "B2RX12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RX12" } ] } ] }, { "uniprot_ac": "E9Q236", "gene_name": "Abcc4", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "E9Q236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q236" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "E9Q236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q236" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "E9Q236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q236" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "E9Q236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q236" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "E9Q236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q236" } ] } ] }, { "uniprot_ac": "F1M3J4", "gene_name": "Abcc4", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] }, { "ec_number": "5.6.1.6", "activity": "ATP + H2O + closed Cl(-) channel = ADP + phosphate + open Cl(-) channel.", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] }, { "ec_number": "5.6.1.6", "activity": "", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] } ] }, { "uniprot_ac": "O15438", "gene_name": "ABCC3", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "O15438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15438" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "O15438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15438" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "O15438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15438" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "O15438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15438" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "O15438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15438" } ] } ] }, { "uniprot_ac": "O15439", "gene_name": "ABCC4", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "O15439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15439" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "O15439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15439" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "O15439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15439" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "O15439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15439" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "O15439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15439" } ] } ] }, { "uniprot_ac": "O15440", "gene_name": "ABCC5", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "O15440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15440" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "O15440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15440" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "O15440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15440" } ] } ] }, { "uniprot_ac": "O35379", "gene_name": "Abcc1", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "O35379", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35379" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "O35379", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35379" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "O35379", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35379" } ] } ] }, { "uniprot_ac": "O88269", "gene_name": "Abcc6", "activity": [ { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "O88269", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88269" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "O88269", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88269" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "O88269", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88269" } ] } ] }, { "uniprot_ac": "O88563", "gene_name": "Abcc3", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "O88563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88563" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "O88563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88563" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "O88563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88563" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "O88563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88563" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "O88563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88563" } ] } ] }, { "uniprot_ac": "O95255", "gene_name": "ABCC6", "activity": [ { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "O95255", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95255" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "O95255", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95255" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "O95255", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95255" } ] } ] }, { "uniprot_ac": "O95342", "gene_name": "ABCB11", "activity": [ { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "O95342", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95342" } ] } ] }, { "uniprot_ac": "P08183", "gene_name": "ABCB1", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "P08183", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08183" } ] }, { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "P08183", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08183" } ] } ] }, { "uniprot_ac": "P13569", "gene_name": "CFTR", "activity": [ { "ec_number": "5.6.1.6", "activity": "ATP + H2O + closed Cl(-) channel = ADP + phosphate + open Cl(-) channel.", "evidence": [ { "id": "P13569", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13569" } ] }, { "ec_number": "5.6.1.6", "activity": "", "evidence": [ { "id": "P13569", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13569" } ] } ] }, { "uniprot_ac": "P33527", "gene_name": "ABCC1", "activity": [ { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "P33527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33527" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "P33527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33527" } ] }, { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "P33527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33527" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "P33527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33527" } ] } ] }, { "uniprot_ac": "P39109", "gene_name": "YCF1", "activity": [ { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "P39109", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39109" } ] }, { "ec_number": "7.2.2.2", "activity": "ATP + Cd(2+)(in) + H2O = ADP + Cd(2+)(out) + H(+) + phosphate.", "evidence": [ { "id": "P39109", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39109" } ] } ] }, { "uniprot_ac": "P53049", "gene_name": "YOR1", "activity": [ { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "P53049", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53049" } ] }, { "ec_number": "7.2.2.2", "activity": "ATP + Cd(2+)(in) + H2O = ADP + Cd(2+)(out) + H(+) + phosphate.", "evidence": [ { "id": "P53049", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53049" } ] } ] }, { "uniprot_ac": "Q15311", "gene_name": "RALBP1", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q15311", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15311" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "Q15311", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15311" } ] } ] }, { "uniprot_ac": "Q5T3U5", "gene_name": "ABCC10", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q5T3U5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5T3U5" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "Q5T3U5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5T3U5" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "Q5T3U5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5T3U5" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q5T3U5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5T3U5" } ] } ] }, { "uniprot_ac": "Q62172", "gene_name": "Ralbp1", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q62172", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62172" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "Q62172", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62172" } ] } ] }, { "uniprot_ac": "Q62796", "gene_name": "Ralbp1", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q62796", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62796" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "Q62796", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62796" } ] } ] }, { "uniprot_ac": "Q63120", "gene_name": "Abcc2", "activity": [ { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "Q63120", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63120" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "Q63120", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63120" } ] }, { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q63120", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63120" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "Q63120", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63120" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q63120", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63120" } ] } ] }, { "uniprot_ac": "Q7TMS5", "gene_name": "Abcg2", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q7TMS5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TMS5" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q7TMS5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TMS5" } ] } ] }, { "uniprot_ac": "Q80W57", "gene_name": "Abcg2", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q80W57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80W57" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q80W57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80W57" } ] } ] }, { "uniprot_ac": "Q8CG09", "gene_name": "Abcc1", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q8CG09", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CG09" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "Q8CG09", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CG09" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q8CG09", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CG09" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "Q8CG09", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CG09" } ] } ] }, { "uniprot_ac": "Q8R4P9", "gene_name": "Abcc10", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q8R4P9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4P9" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "Q8R4P9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4P9" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "Q8R4P9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4P9" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q8R4P9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4P9" } ] } ] }, { "uniprot_ac": "Q8VI47", "gene_name": "Abcc2", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q8VI47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VI47" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "Q8VI47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VI47" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "Q8VI47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VI47" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "Q8VI47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VI47" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q8VI47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VI47" } ] } ] }, { "uniprot_ac": "Q92887", "gene_name": "ABCC2", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q92887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92887" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "Q92887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92887" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "Q92887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92887" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q92887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92887" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "Q92887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92887" } ] } ] }, { "uniprot_ac": "Q96J66", "gene_name": "ABCC11", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q96J66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96J66" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "Q96J66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96J66" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q96J66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96J66" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "Q96J66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96J66" } ] } ] }, { "uniprot_ac": "Q9QY30", "gene_name": "Abcb11", "activity": [ { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "Q9QY30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QY30" } ] } ] }, { "uniprot_ac": "Q9R1S7", "gene_name": "Abcc6", "activity": [ { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "Q9R1S7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1S7" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "Q9R1S7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1S7" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "Q9R1S7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1S7" } ] } ] }, { "uniprot_ac": "Q9UNQ0", "gene_name": "ABCG2", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q9UNQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNQ0" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q9UNQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNQ0" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 16 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 171 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }