{ "uniprot_canonical_ac": "Q924Y0-1", "uniprot_ac": "Q924Y0", "uniprot_id": "BODG_MOUSE", "mass": { "chemical_mass": 44699.0, "monoisotopic_mass": 44699.0 }, "refseq": { "ac": "NP_569719", "name": "gamma-butyrobetaine dioxygenase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_569719" }, "gene_names": [ { "name": "Bbox1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q924Y0", "id": "Q924Y0" }, { "name": "Bbox1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_569719", "id": "NP_569719" } ], "protein_names": [ { "name": "Gamma-butyrobetaine dioxygenase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q924Y0" }, { "name": "1.14.11.1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q924Y0" }, { "name": "Gamma-BBH", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q924Y0" }, { "name": "Gamma-butyrobetaine hydroxylase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q924Y0" }, { "name": "Gamma-butyrobetaine,2-oxoglutarate dioxygenase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q924Y0" }, { "name": "gamma-butyrobetaine dioxygenase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_569719", "id": "NP_569719" }, { "name": "gamma-butyrobetaine,2-oxoglutarate dioxygenase; gamma-butyrobetaine hydroxylase; gamma-BBH; butyrobetaine (gamma), 2-oxoglutarate dioxygenase 1 (gamma-butyrobetaine hydroxylase)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_569719", "id": "NP_569719" } ], "function": [ { "annotation": "BBOX 1 expression was increased in the medial frontal cortex of a mouse model of schizophrenia induced by maternal immune activation.", "evidence": [ { "database": "RefSeq", "id": "NP_569719", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_569719" }, { "database": "PubMed", "id": "29065368", "url": "https://glygen.org/publication/PubMed/29065368" } ] }, { "annotation": "Catalyzes the formation of L-carnitine from gamma-butyrobetaine.", "evidence": [ { "database": "UniProtKB", "id": "Q924Y0", "url": "https://www.uniprot.org/uniprot/Q924Y0#function" } ] }, { "annotation": "Study clearly shows that mouse gamma-butyrobetaine dioxygenase is a direct PPARalpha target gene", "evidence": [ { "database": "RefSeq", "id": "NP_569719", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_569719" }, { "database": "PubMed", "id": "21549104", "url": "https://glygen.org/publication/PubMed/21549104" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q924Y0", "url": "https://www.uniprot.org/uniprot/Q924Y0" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Bbox1", "url": "https://www.uniprot.org/uniprot/Q924Y0", "locus": { "chromosome": "2", "start_pos": 110093042, "end_pos": 110144905, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000041660", "url": "https://www.ensembl.org/id/ENSMUSG00000041660" } ] } } ], "crossref": [ { "id": "ENSMUSG00000041660", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000041660", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00250", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00250", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "170442", "url": "https://www.ncbi.nlm.nih.gov/gene/170442", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003819", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003819", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010376", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010376", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012775", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012775", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038492", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038492", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042098", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042098", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:170442", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:170442", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1891372", "url": "http://www.informatics.jax.org/marker/MGI:1891372", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q924Y0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q924Y0", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "AFHIADR", "url": "https://omabrowser.org/oma/group/AFHIADR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5485575at2759", "url": "http://www.orthodb.org/?query=5485575at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10696", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10696", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10696:SF33", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10696:SF33", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02668", "url": "http://pfam.xfam.org/family/PF02668", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF06155", "url": "http://pfam.xfam.org/family/PF06155", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q924Y0", "url": "http://purl.obolibrary.org/obo/PR_Q924Y0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-71262", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-71262", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_569719", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_569719", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "24028", "url": "https://www.rhea-db.org/rhea/24028", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A2AGK3", "url": "https://www.uniprot.org/uniprot/A2AGK3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2AGK3-1", "url": "https://www.uniprot.org/uniprot/A2AGK3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q924Y0", "url": "https://www.uniprot.org/uniprot/Q924Y0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q924Y0-1", "url": "https://www.uniprot.org/uniprot/Q924Y0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MHCAILKAEAVDGAHLMQIFWHDGAESLYPAVWLRDNCQCSDCYLHSAKARKLLLEALDVNIRIDDLTFDRKKVYITWPNDHYSEFEANWLKKRCFSQQARARLQGELFLPECQYWGSELQLPTLNFEDVLNDDDHAYKWLSSLKKVGIVRLTGAADKRGEIIKLGKRIGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKEKNPQAFHILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRVNFNNATRDTVFDVPIERVQPFYAALKEFVDLMNSKEYKYTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVTNGN", "length": 387, "header": "sp|Q924Y0-1|BODG_MOUSE Isoform 1 of Gamma-butyrobetaine dioxygenase OS=Mus musculus OX=10090 GN=Bbox1 PE=1 SV=1 CANONICAL=Q924Y0-1" }, "isoforms": [ { "isoform_ac": "A2AGK3-1", "url": "", "sequence": { "sequence": "MHCAILKAEAVDGAHLMQIFWHDGAESLYPAVWLRDNCQCSDCYLHSAKARKLLLEALDVNIRIDDLTFDRKKVYITWPNDHYSEFEANWLKKRCFSQQARARLQGELFLPECQYWGSELQLPTLNFEDVLNDDDHAYKWLSSLK", "length": 145, "header": "tr|A2AGK3-1|BODG_MOUSE Computationally mapped isoform of Gamma-butyrobetaine dioxygenase OS=Mus musculus OX=10090 GN=Bbox1 PE=1 SV=1 CANONICAL=Q924Y0-1" }, "locus": { "chromosome": "2", "start_pos": 110135977, "end_pos": 110122853, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000133608.2", "url": "https://www.ensembl.org/id/ENSMUST00000133608.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000116663.2", "url": "https://www.ensembl.org/id/ENSMUSP00000116663.2" } ] } }, { "isoform_ac": "Q924Y0-1", "url": "", "sequence": { "sequence": "MHCAILKAEAVDGAHLMQIFWHDGAESLYPAVWLRDNCQCSDCYLHSAKARKLLLEALDVNIRIDDLTFDRKKVYITWPNDHYSEFEANWLKKRCFSQQARARLQGELFLPECQYWGSELQLPTLNFEDVLNDDDHAYKWLSSLKKVGIVRLTGAADKRGEIIKLGKRIGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKEKNPQAFHILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRVNFNNATRDTVFDVPIERVQPFYAALKEFVDLMNSKEYKYTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVTNGN", "length": 387, "header": "sp|Q924Y0-1|BODG_MOUSE Isoform 1 of Gamma-butyrobetaine dioxygenase OS=Mus musculus OX=10090 GN=Bbox1 PE=1 SV=1 CANONICAL=Q924Y0-1" }, "locus": { "chromosome": "2", "start_pos": 110135977, "end_pos": 110095802, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000046233", "url": "https://www.ensembl.org/id/ENSMUST00000046233" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000046302", "url": "https://www.ensembl.org/id/ENSMUSP00000046302" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q924Y0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q924Y0" }, { "id": "34887587", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34887587" } ] } ], "phosphorylation": [ { "start_pos": 351, "end_pos": 351, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q924Y0", "url": "https://www.uniprot.org/uniprot/Q924Y0" } ], "site_lbl": "Ser351" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Mouse gamma-butyrobetaine dioxygenase is regulated by peroxisome proliferator-activated receptor alpha through a PPRE located in the proximal promoter.", "journal": "Biochemical pharmacology", "date": "2011", "authors": "Wen G, Kuhne H, Rauer C, Ringseis R, Eder K", "evidence": [ { "database": "RefSeq", "id": "NP_569719", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_569719" } ], "reference": [ { "type": "PubMed", "id": "21549104", "url": "https://glygen.org/publication/PubMed/21549104" } ] }, { "title": "BBOX1 is down-regulated in maternal immune-activated mice and implicated in genetic susceptibility to human schizophrenia.", "journal": "Psychiatry research", "date": "2018", "authors": "Lee H, Kim HK, Kwon JT, Park S, Park HJ, Kim SK, Park JK, Kang WS, Kim YJ, Chung JH, Kim JW, Kim HJ", "evidence": [ { "database": "RefSeq", "id": "NP_569719", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_569719" } ], "reference": [ { "type": "PubMed", "id": "29065368", "url": "https://glygen.org/publication/PubMed/29065368" } ] }, { "title": "Dynamic eIF3a O-GlcNAcylation controls translation reinitiation during nutrient stress.", "journal": "Nature chemical biology", "date": "2022", "authors": "Shu XE, Mao Y, Jia L, Qian SB", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q924Y0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q924Y0" } ], "reference": [ { "type": "PubMed", "id": "34887587", "url": "https://glygen.org/publication/PubMed/34887587" } ] } ], "pathway": [ { "id": "mmu:170442", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:170442", "resource": "KEGG Pathway" }, { "id": "R-MMU-71262", "name": "Carnitine synthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-71262", "resource": "Reactome", "description": "Carnitine synthesis" } ], "orthologs": [ { "uniprot_canonical_ac": "O75936-1", "protein_name": "Gamma-butyrobetaine dioxygenase", "gene_name": "BBOX1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN", "length": 387 }, "evidence": [ { "id": "45237501", "url": "http://www.informatics.jax.org/homology/45237501", "database": "MGI" }, { "id": "Q924Y0", "url": "https://omabrowser.org/oma/group/Q924Y0/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9QZU7-1", "protein_name": "Gamma-butyrobetaine dioxygenase", "gene_name": "Bbox1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MHCAILKAEAVDGARLMQIFWHDGAESLYPAVWLRDNCQCSDCYLHSAKARKLLLEALDVNIRMDDLTFDQKKVYITWPNGHYSEFEANWLKKRCFSQEARAGLQGELFLPECQYWGSELQLPTLNFEDVLNDDDHAYKWLSSLKKVGIVRLTGAADKRGEIIKLGKRIGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKEKNPQAFSILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTVFDVPIERVQPFYAALKEFVDLMNSKEYKYTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVMNGN", "length": 387 }, "evidence": [ { "id": "45237501", "url": "http://www.informatics.jax.org/homology/45237501", "database": "MGI" }, { "id": "Q924Y0", "url": "https://omabrowser.org/oma/group/Q924Y0/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q924Y0", "url": "https://www.uniprot.org/uniprot/Q924Y0" } ], "pmid": "" }, { "name": "iron ion binding", "id": "GO:0005506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005506", "evidence": [ { "database": "UniProtKB", "id": "Q924Y0", "url": "https://www.uniprot.org/uniprot/Q924Y0" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "Q924Y0", "url": "https://www.uniprot.org/uniprot/Q924Y0" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q924Y0", "url": "https://www.uniprot.org/uniprot/Q924Y0" } ], "pmid": "" }, { "name": "gamma-butyrobetaine dioxygenase activity", "id": "GO:0008336", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008336", "evidence": [ { "database": "UniProtKB", "id": "Q924Y0", "url": "https://www.uniprot.org/uniprot/Q924Y0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q924Y0", "url": "https://www.uniprot.org/uniprot/Q924Y0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "carnitine biosynthetic process", "id": "GO:0045329", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045329", "evidence": [ { "database": "UniProtKB", "id": "Q924Y0", "url": "https://www.uniprot.org/uniprot/Q924Y0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 293, "end_pos": 295, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "24028", "name": "", "equation": "2-oxoglutarate + 4-(trimethylamino)butanoate + O2 = carnitine + CO2 + succinate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QZU7-1", "O75936-1", "Q924Y0-1" ], "evidence": [ { "id": "24028", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/24028" } ] }, { "id": "R-MMU-71261", "name": "BBOX1:AscH-:Fe2+ dimer dioxygenates TEABT and 2OG to form CAR and SUCCA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-ALL-30235" ], "enzyme_list": [ "Q924Y0-1" ], "evidence": [ { "id": "R-MMU-71261", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-71261" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-30235", "participant_name": "CAR [cytosol]", "crossref": [ { "id": "C00487", "database": "COMPOUND", "url": "" }, { "id": "17126", "database": "ChEBI", "url": "" }, { "id": "8145619", "database": "PubChem Substance", "url": "" }, { "id": "000000154729", "database": "ZINC", "url": "" }, { "id": "000003079340", "database": "ZINC", "url": "" }, { "id": "C00487", "database": "COMPOUND", "url": "" }, { "id": "17126", "database": "ChEBI", "url": "" }, { "id": "8145619", "database": "PubChem Substance", "url": "" }, { "id": "000000154729", "database": "ZINC", "url": "" }, { "id": "000003079340", "database": "ZINC", "url": "" }, { "id": "C00487", "database": "COMPOUND", "url": "" }, { "id": "17126", "database": "ChEBI", "url": "" }, { "id": "8145619", "database": "PubChem Substance", "url": "" }, { "id": "000000154729", "database": "ZINC", "url": "" }, { "id": "000003079340", "database": "ZINC", "url": "" }, { "id": "17126", "database": "ChEBI", "url": "" }, { "id": "000000154729", "database": "ZINC", "url": "" }, { "id": "C00487", "database": "COMPOUND", "url": "" }, { "id": "000003079340", "database": "ZINC", "url": "" }, { "id": "8145619", "database": "PubChem Substance", "url": "" }, { "id": "C00487", "database": "COMPOUND", "url": "" }, { "id": "17126", "database": "ChEBI", "url": "" }, { "id": "8145619", "database": "PubChem Substance", "url": "" }, { "id": "000000154729", "database": "ZINC", "url": "" }, { "id": "000003079340", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O75936", "gene_name": "BBOX1", "activity": [ { "ec_number": "1.14.11.1", "activity": "2-oxoglutarate + 4-(trimethylamino)butanoate + O2 = carnitine + CO2 + succinate.", "evidence": [ { "id": "O75936", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75936" } ] }, { "ec_number": "1.14.11.1", "activity": "", "evidence": [ { "id": "O75936", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75936" } ] } ] }, { "uniprot_ac": "Q924Y0", "gene_name": "Bbox1", "activity": [ { "ec_number": "1.14.11.1", "activity": "2-oxoglutarate + 4-(trimethylamino)butanoate + O2 = carnitine + CO2 + succinate.", "evidence": [ { "id": "Q924Y0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q924Y0" } ] }, { "ec_number": "1.14.11.1", "activity": "", "evidence": [ { "id": "Q924Y0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q924Y0" } ] } ] }, { "uniprot_ac": "Q9QZU7", "gene_name": "Bbox1", "activity": [ { "ec_number": "1.14.11.1", "activity": "2-oxoglutarate + 4-(trimethylamino)butanoate + O2 = carnitine + CO2 + succinate.", "evidence": [ { "id": "Q9QZU7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZU7" } ] }, { "ec_number": "1.14.11.1", "activity": "", "evidence": [ { "id": "Q9QZU7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZU7" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }