{
    "uniprot_canonical_ac": "Q923Y2-1",
    "uniprot_ac": "Q923Y2",
    "uniprot_id": "TAA7A_RAT",
    "mass": {
        "chemical_mass": 40147.0,
        "monoisotopic_mass": 40147.0
    },
    "refseq": {
        "ac": "NP_783175",
        "name": "trace amine-associated receptor 7a",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_783175"
    },
    "gene_names": [
        {
            "name": "Taar7a",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q923Y2",
            "id": "Q923Y2"
        },
        {
            "name": "Ta8",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_783175",
            "id": "NP_783175"
        },
        {
            "name": "Ta8",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q923Y2",
            "id": "Q923Y2"
        },
        {
            "name": "Taar7a",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_783175",
            "id": "NP_783175"
        },
        {
            "name": "Tar8",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q923Y2",
            "id": "Q923Y2"
        },
        {
            "name": "Trar8",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q923Y2",
            "id": "Q923Y2"
        }
    ],
    "protein_names": [
        {
            "name": "Trace amine-associated receptor 7a",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q923Y2"
        },
        {
            "name": "TaR-7a",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q923Y2"
        },
        {
            "name": "TaR-8",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q923Y2"
        },
        {
            "name": "Trace amine receptor 7a",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q923Y2"
        },
        {
            "name": "Trace amine receptor 8",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q923Y2"
        },
        {
            "name": "taR-8; taR-7a; trace amine receptor 7a; trace amine receptor 8",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_783175",
            "id": "NP_783175"
        },
        {
            "name": "trace amine-associated receptor 7a",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_783175",
            "id": "NP_783175"
        }
    ],
    "function": [
        {
            "annotation": "Orphan receptor. Could be a receptor for trace amines. Trace amines are biogenic amines present in very low levels in mammalian tissues. Although some trace amines have clearly defined roles as neurotransmitters in invertebrates, the extent to which they function as true neurotransmitters in vertebrates has remained speculative. Trace amines are likely to be involved in a variety of physiological functions that have yet to be fully understood.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q923Y2",
                    "url": "https://www.uniprot.org/uniprot/Q923Y2#function"
                }
            ]
        },
        {
            "annotation": "Shows that expression of Taar family members is limited to specific tissue subpopulations and developmental stages in mouse.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_783175",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_783175"
                },
                {
                    "database": "PubMed",
                    "id": "17556730",
                    "url": "https://glygen.org/publication/PubMed/17556730"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Rattus norvegicus",
            "taxid": 10116,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q923Y2",
                    "url": "https://www.uniprot.org/uniprot/Q923Y2"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "gene": [
        {
            "name": "Taar7a",
            "url": "https://www.uniprot.org/uniprot/Q923Y2",
            "locus": {
                "chromosome": "1",
                "start_pos": 21453692,
                "end_pos": 21450595,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSRNOG00000062468",
                        "url": "https://www.ensembl.org/id/ENSRNOG00000062468"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "294125",
            "url": "https://www.ncbi.nlm.nih.gov/gene/294125",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR000276",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR009132",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR009132",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017452",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "rno:294125",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:294125",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "CQIAVNS",
            "url": "https://omabrowser.org/oma/group/CQIAVNS/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "2901788at2759",
            "url": "http://www.orthodb.org/?query=2901788at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR24249",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24249",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR24249:SF78",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24249:SF78",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00001",
            "url": "http://pfam.xfam.org/family/PF00001",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q923Y2",
            "url": "http://purl.obolibrary.org/obo/PR_Q923Y2",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_783175",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_783175",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "631387",
            "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=631387",
            "database": "RGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "Q923Y2",
            "url": "https://www.uniprot.org/uniprot/Q923Y2",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q923Y2-1",
            "url": "https://www.uniprot.org/uniprot/Q923Y2-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MDKLVDNFLSGQSRTMSEDLLSASSPQLCYENLNGSCIRSPYSPGPRLILYAVFGFGAVLAVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSTVRSVEGCWYFGDTYCKFHSCFEGSFCYSSIFHLCFISVDRYIAVSDPLIYPTRFTASVSGKCITFSWLLSIIYSFSLLYTGANEAGLEDLVSALTCVGGCQIAVNQSWVFINFLLFLVPTLVMMTVYSKIFLIAKQQAQNIEKMSKQTTRASESYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLGFITPTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRQNSSVTNLFPE",
        "length": 358,
        "header": "sp|Q923Y2-1|TAA7A_RAT Isoform 1 of Trace amine-associated receptor 7a  OS=Rattus norvegicus OX=10116 GN=Taar7a PE=3 SV=1 CANONICAL=Q923Y2-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q923Y2-1",
            "url": "",
            "sequence": {
                "sequence": "MDKLVDNFLSGQSRTMSEDLLSASSPQLCYENLNGSCIRSPYSPGPRLILYAVFGFGAVLAVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSTVRSVEGCWYFGDTYCKFHSCFEGSFCYSSIFHLCFISVDRYIAVSDPLIYPTRFTASVSGKCITFSWLLSIIYSFSLLYTGANEAGLEDLVSALTCVGGCQIAVNQSWVFINFLLFLVPTLVMMTVYSKIFLIAKQQAQNIEKMSKQTTRASESYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLGFITPTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRQNSSVTNLFPE",
                "length": 358,
                "header": "sp|Q923Y2-1|TAA7A_RAT Isoform 1 of Trace amine-associated receptor 7a  OS=Rattus norvegicus OX=10116 GN=Taar7a PE=3 SV=1 CANONICAL=Q923Y2-1"
            },
            "locus": {
                "chromosome": "1",
                "start_pos": 21452006,
                "end_pos": 21450933,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSRNOT00000061221",
                        "url": "https://www.ensembl.org/id/ENSRNOT00000061221"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSRNOP00000079118",
                        "url": "https://www.ensembl.org/id/ENSRNOP00000079118"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 210,
            "start_aa": "Asn",
            "end_pos": 210,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn210",
            "evidence": [
                {
                    "id": "Q923Y2",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q923Y2#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 34,
            "start_aa": "Asn",
            "end_pos": 34,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn34",
            "evidence": [
                {
                    "id": "Q923Y2",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q923Y2#ptm_processing"
                }
            ]
        }
    ],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "glycoprotein",
        "glycoprotein_predicted"
    ],
    "publication": [
        {
            "title": "Trace amines: identification of a family of mammalian G protein-coupled receptors.",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "2001",
            "authors": "Borowsky B, Adham N, Jones KA, Raddatz R, Artymyshyn R, Ogozalek KL, Durkin MM, Lakhlani PP, Bonini JA, Pathirana S, Boyle N, Pu X, Kouranova E, Lichtblau H, Ochoa FY, Branchek TA, Gerald C",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q923Y2",
                    "url": "https://www.uniprot.org/uniprot/Q923Y2"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11459929",
                    "url": "https://glygen.org/publication/PubMed/11459929"
                }
            ]
        },
        {
            "title": "Expression of trace amine-associated receptors in the Grueneberg ganglion.",
            "journal": "Chemical senses",
            "date": "2007",
            "authors": "Fleischer J, Schwarzenbacher K, Breer H",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_783175",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_783175"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17556730",
                    "url": "https://glygen.org/publication/PubMed/17556730"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "rno:294125",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:294125",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q5QD12-1",
            "protein_name": "Trace amine-associated receptor 7a",
            "gene_name": "Taar7a",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MDKLVDHFLSDQSRTMNEDLFSATSTELCYENLNRSCVRSPYSPGPRLILYAVFGFGAALAVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSTVRSVEGCWYFGESYCKFHSCFEGSFCYSSIFHLCFISVDRYIAVSDPLTYPTRFTASVSGKCITFSWLLSIIYSFSLLYTGANEAGLEDLVSVLTCVGGCQIAVNQSWVFINFLLFLIPTLVMMTVYSKIFLIAKQQAQNIEKMSKQTARASESYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLGFITPTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRENSSTTNLFPE",
                "length": 358
            },
            "evidence": [
                {
                    "id": "45227834",
                    "url": "http://www.informatics.jax.org/homology/45227834",
                    "database": "MGI"
                },
                {
                    "id": "Q923Y2",
                    "url": "https://omabrowser.org/oma/group/Q923Y2/",
                    "database": "OMA"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q923Y2",
                                "url": "https://www.uniprot.org/uniprot/Q923Y2"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 1,
                "go_terms": [
                    {
                        "name": "trace-amine receptor activity",
                        "id": "GO:0001594",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001594",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q923Y2",
                                "url": "https://www.uniprot.org/uniprot/Q923Y2"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 210,
            "end_pos": 212,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 349,
            "end_pos": 351,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 34,
            "end_pos": 36,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                },
                {
                    "field": "total_sites",
                    "count": 2
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 2
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                },
                {
                    "field": "total_sites",
                    "count": 2
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 2
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}