{ "uniprot_canonical_ac": "Q922Z1-1", "uniprot_ac": "Q922Z1", "uniprot_id": "LDAF1_MOUSE", "mass": { "chemical_mass": 17643.0, "monoisotopic_mass": 17643.0 }, "refseq": { "ac": "NP_663561", "name": "lipid droplet assembly factor 1 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663561" }, "gene_names": [ { "name": "Ldaf1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q922Z1", "id": "Q922Z1" }, { "name": "8430420C20Rik; Tmem159", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663561", "id": "NP_663561" }, { "name": "Ldaf1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663561", "id": "NP_663561" }, { "name": "Tmem159", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q922Z1", "id": "Q922Z1" } ], "protein_names": [ { "name": "Lipid droplet assembly factor 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q922Z1" }, { "name": "Promethin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q922Z1" }, { "name": "Transmembrane protein 159", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q922Z1" }, { "name": "lipid droplet assembly factor 1 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663561", "id": "NP_663561" }, { "name": "promethin; transmembrane protein 159", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663561", "id": "NP_663561" } ], "function": [ { "annotation": "Plays an important role in the formation of lipid droplets (LD) which are storage organelles at the center of lipid and energy homeostasis (By similarity). In association with BSCL2/seipin, defines the sites of LD formation in the endoplasmic reticulum (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q922Z1", "url": "https://www.uniprot.org/uniprot/Q922Z1#function" }, { "database": "UniProtKB", "id": "Q96B96", "url": "https://www.uniprot.org/uniprot/Q96B96#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q922Z1", "url": "https://www.uniprot.org/uniprot/Q922Z1" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Ldaf1", "url": "https://www.uniprot.org/uniprot/Q922Z1", "locus": { "chromosome": "7", "start_pos": 119720215, "end_pos": 119701576, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000030917", "url": "https://www.ensembl.org/id/ENSMUSG00000030917" } ] } } ], "crossref": [ { "id": "ENSMUSG00000030917", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000030917", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "233806", "url": "https://www.ncbi.nlm.nih.gov/gene/233806", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR029709", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029709", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:233806", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:233806", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1925752", "url": "http://www.informatics.jax.org/marker/MGI:1925752", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "VNYWFPP", "url": "https://omabrowser.org/oma/group/VNYWFPP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5358038at2759", "url": "http://www.orthodb.org/?query=5358038at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR14275", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14275", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14275:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14275:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF16015", "url": "http://pfam.xfam.org/family/PF16015", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q922Z1", "url": "http://purl.obolibrary.org/obo/PR_Q922Z1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_663561", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663561", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q922Z1", "url": "https://www.uniprot.org/uniprot/Q922Z1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q922Z1-1", "url": "https://www.uniprot.org/uniprot/Q922Z1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAKEEPPSVSRDLQELQRKLGLLLESFLNNSKVVAFMKSPVGRFLDRHPFVTLTVLMFVTMSAIPVGFFLLIVVLTSLGALMGAILLEGLVISVCGLSLLCVLCGLGFLSLALSGIAMMSYVVVSCLMSYWFSPSRPLTQQNANVDCQLAMKFTESERLIF", "length": 161, "header": "sp|Q922Z1-1|LDAF1_MOUSE Isoform 1 of Lipid droplet assembly factor 1 OS=Mus musculus OX=10090 GN=Ldaf1 PE=2 SV=1 CANONICAL=Q922Z1-1" }, "isoforms": [ { "isoform_ac": "Q922Z1-1", "url": "", "sequence": { "sequence": "MAKEEPPSVSRDLQELQRKLGLLLESFLNNSKVVAFMKSPVGRFLDRHPFVTLTVLMFVTMSAIPVGFFLLIVVLTSLGALMGAILLEGLVISVCGLSLLCVLCGLGFLSLALSGIAMMSYVVVSCLMSYWFSPSRPLTQQNANVDCQLAMKFTESERLIF", "length": 161, "header": "sp|Q922Z1-1|LDAF1_MOUSE Isoform 1 of Lipid droplet assembly factor 1 OS=Mus musculus OX=10090 GN=Ldaf1 PE=2 SV=1 CANONICAL=Q922Z1-1" }, "locus": { "chromosome": "7", "start_pos": 119719475, "end_pos": 119703957, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000118737", "url": "https://www.ensembl.org/id/ENSMUST00000118737" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000114085", "url": "https://www.ensembl.org/id/ENSMUSP00000114085" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Identification of promethin and PGLP as two novel up-regulated genes in PPARgamma1-induced adipogenic mouse liver.", "journal": "Biochimie", "date": "2004", "authors": "Yu S, Viswakarma N, Batra SK, Sambasiva Rao M, Reddy JK", "evidence": [ { "database": "UniProtKB", "id": "Q922Z1", "url": "https://www.uniprot.org/uniprot/Q922Z1" } ], "reference": [ { "type": "PubMed", "id": "15589683", "url": "https://glygen.org/publication/PubMed/15589683" } ] } ], "pathway": [ { "id": "mmu:233806", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:233806", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q6UK00-1", "protein_name": "Lipid droplet assembly factor 1", "gene_name": "Ldaf1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAEEEPSSVSRDLQELQRKLGLLLESFQNNSKVVAFMKSPVGRFLDRHPFLVLTVLMFVTMSAIPVGFFLLIVVLTSLGALMGAILLEGLVISVCGLSLLCILCGLGFVSLALSGITMMSYVVVSCLMSYWFSPSRPPTQQHANIDSQLAMKFTESEKLGL", "length": 161 }, "evidence": [ { "id": "45241900", "url": "http://www.informatics.jax.org/homology/45241900", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q96B96-1", "protein_name": "Lipid droplet assembly factor 1", "gene_name": "LDAF1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAKEEPQSISRDLQELQKKLSLLIDSFQNNSKVVAFMKSPVGQYLDSHPFLAFTLLVFIVMSAVPVGFFLLIVVLTTLAALLGVIILEGLVISVGGFSLLCILCGLGFVSLAMSGMMIASYVVVSSLISCWFSPRPLTQQNTSCDFLPAMKSAEFEGLYQE", "length": 161 }, "evidence": [ { "id": "45241900", "url": "http://www.informatics.jax.org/homology/45241900", "database": "MGI" }, { "id": "Q922Z1", "url": "https://omabrowser.org/oma/group/Q922Z1/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "lipid droplet", "id": "GO:0005811", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005811", "evidence": [ { "database": "UniProtKB", "id": "Q922Z1", "url": "https://www.uniprot.org/uniprot/Q922Z1" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "Q922Z1", "url": "https://www.uniprot.org/uniprot/Q922Z1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "lipid droplet formation", "id": "GO:0140042", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140042", "evidence": [ { "database": "UniProtKB", "id": "Q922Z1", "url": "https://www.uniprot.org/uniprot/Q922Z1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 29, "end_pos": 31, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }