{ "uniprot_canonical_ac": "Q922K7-1", "uniprot_ac": "Q922K7", "uniprot_id": "NOP2_MOUSE", "mass": { "chemical_mass": 86752.0, "monoisotopic_mass": 86752.0 }, "refseq": { "ac": "NP_620086", "name": "probable 28S rRNA (cytosine-C(5))-methyltransferase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620086" }, "gene_names": [ { "name": "Nop2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q922K7", "id": "Q922K7" }, { "name": "120kDa; A530002O17; Nol1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620086", "id": "NP_620086" }, { "name": "Nol1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q922K7", "id": "Q922K7" }, { "name": "Nop2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620086", "id": "NP_620086" } ], "protein_names": [ { "name": "Probable 28S rRNA (cytosine-C(5))-methyltransferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q922K7" }, { "name": "2.1.1.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q922K7" }, { "name": "Nucleolar protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q922K7" }, { "name": "Nucleolar protein 2 homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q922K7" }, { "name": "Proliferating-cell nucleolar antigen p120", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q922K7" }, { "name": "Proliferation-associated nucleolar protein p120", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q922K7" }, { "name": "probable 28S rRNA (cytosine-C(5))-methyltransferase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620086", "id": "NP_620086" }, { "name": "putative ribosomal RNA methyltransferase NOP2; nucleolar protein 2 homolog; proliferating-cell nucleolar antigen p120; proliferation-associated nucleolar protein p120; nucleolar protein 1, 120 kDa; NOP2 nucleolar protein homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620086", "id": "NP_620086" } ], "function": [ { "annotation": "Findings suggest a newly discovered role of Nop2 in both mature neurons and in cells possibly involved in the regeneration of nervous tissue", "evidence": [ { "database": "RefSeq", "id": "NP_620086", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620086" }, { "database": "PubMed", "id": "25481415", "url": "https://glygen.org/publication/PubMed/25481415" } ] }, { "annotation": "Inappropriate expression of the p120 gene can result in aberrant neutrophil maturation.", "evidence": [ { "database": "RefSeq", "id": "NP_620086", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620086" }, { "database": "PubMed", "id": "16641140", "url": "https://glygen.org/publication/PubMed/16641140" } ] }, { "annotation": "Involved in ribosomal large subunit assembly. S-adenosyl-L-methionine-dependent methyltransferase that specifically methylates the C(5) position of cytosine 4447 in 28S rRNA. May play a role in the regulation of the cell cycle and the increased nucleolar activity that is associated with the cell proliferation.", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7#function" }, { "database": "UniProtKB", "id": "P46087", "url": "https://www.uniprot.org/uniprot/P46087#function" } ] }, { "annotation": "Results demonstrate that Nop2 is an essential gene for blastocyst formation, and is required for RNA processing and/or stability in vivo during preimplantation embryo development in the mouse.", "evidence": [ { "database": "RefSeq", "id": "NP_620086", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620086" }, { "database": "PubMed", "id": "26632338", "url": "https://glygen.org/publication/PubMed/26632338" } ] }, { "annotation": "The nucleolar protein NOP2 is required for nucleolar maturation and ribosome biogenesis during preimplantation development in mammals.", "evidence": [ { "database": "RefSeq", "id": "NP_620086", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620086" }, { "database": "PubMed", "id": "31908012", "url": "https://glygen.org/publication/PubMed/31908012" } ] } ], "disease": [ { "disease_id": "DOID:162", "recommended_name": { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "cancer", "description": "A disease of cellular proliferation that is malignant and primary, characterized by uncontrolled cellular proliferation, local cell invasion and metastasis." }, "synonyms": [ { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "malignant neoplasm", "description": "" }, { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "malignant tumor", "description": "" }, { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "primary cancer", "description": "" } ], "evidence": [ { "id": "162", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:162" } ] }, { "disease_id": "DOID:1928", "recommended_name": { "id": "DOID:1928", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1928", "name": "Williams-Beuren syndrome", "description": "A syndrome that is characterized by mild to moderate intellectual disability, a broad forehead, a short nose with a broad tip, full cheeks, and a wide mouth with full lips and difficulty with visual-spatial tasks and has_material_basis_in hemizygous deletion of 1.5 to 1.8 Mb on chromosome 7q11.23." }, "synonyms": [ { "id": "DOID:1928", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1928", "name": "Fanconi Schlesinger syndrome", "description": "" }, { "id": "MONDO:0008678", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008678", "name": "Williams syndrome", "description": "A rare genetic multisystemic neurodevelopmental disorder characterized by a distinct facial appearance, cardiac anomalies (most frequently supravalvular aortic stenosis), cognitive and developmental abnormalities, and connective tissue abnormalities (such as joint laxity)" }, { "id": "MONDO:0008678", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008678", "name": "Fanconi Schlesinger syndrome", "description": "" }, { "id": "MONDO:0008678", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008678", "name": "Williams syndrome", "description": "" }, { "id": "MONDO:0008678", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008678", "name": "Williams-Beuren syndrome", "description": "" }, { "id": "MONDO:0008678", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008678", "name": "Williams-Beuren syndrome (WBS)", "description": "" }, { "id": "MONDO:0008678", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008678", "name": "deletion 7q11.23", "description": "" }, { "id": "MONDO:0008678", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008678", "name": "monosomy 7q11.23", "description": "" }, { "id": "MONDO:0008678", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008678", "name": "WBS", "description": "" }, { "id": "MONDO:0008678", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008678", "name": "WMS", "description": "" }, { "id": "MONDO:0008678", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008678", "name": "chromosome 7Q11.23 deletion syndrome, 1.5- to 1.8-Mb", "description": "" } ], "evidence": [ { "id": "1928", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1928" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Nop2", "url": "https://www.uniprot.org/uniprot/Q922K7", "locus": { "chromosome": "6", "start_pos": 125121716, "end_pos": 125108872, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000038279", "url": "https://www.ensembl.org/id/ENSMUSG00000038279" } ] } } ], "crossref": [ { "id": "ENSMUSG00000038279", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000038279", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd02440", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02440", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "110109", "url": "https://www.ncbi.nlm.nih.gov/gene/110109", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q922K7", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q922K7*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001678", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001678", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011023", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011023", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012586", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012586", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018314", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018314", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023267", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023267", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023273", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023273", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029063", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029063", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR031341", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031341", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:110109", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:110109", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "107891", "url": "http://www.informatics.jax.org/marker/MGI:107891", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q922K7", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q922K7", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PENCVQP", "url": "https://omabrowser.org/oma/group/PENCVQP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1268at2759", "url": "http://www.orthodb.org/?query=1268at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR22807", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22807", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22807:SF30", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22807:SF30", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01189", "url": "http://pfam.xfam.org/family/PF01189", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08062", "url": "http://pfam.xfam.org/family/PF08062", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF17125", "url": "http://pfam.xfam.org/family/PF17125", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q922K7", "url": "http://purl.obolibrary.org/obo/PR_Q922K7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "47788", "url": "https://www.rhea-db.org/rhea/47788", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0N4SW16", "url": "https://www.uniprot.org/uniprot/A0A0N4SW16", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0N4SW16-1", "url": "https://www.uniprot.org/uniprot/A0A0N4SW16-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9QN31", "url": "https://www.uniprot.org/uniprot/E9QN31", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9QN31-1", "url": "https://www.uniprot.org/uniprot/E9QN31-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q922K7-1", "url": "https://www.uniprot.org/uniprot/Q922K7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGRKLDPTKKEKRGPGRKARKQKGAETELVRFLPAAGDENSKRLSSRARKRAAKRRAGSVDVPKPNKSPGIKTLPGELSKGAVQARGKKRPAPIQNSDGDEEEDSGEDDVVTQGDLWGSEDSDEDMVDDYGAASNSEDEEEKLLPIERAALKQKAQDATAGVLWNEEDTDEDEDDDGVSPESHPRKDDKAEGDLQINVEDEEAFVLPPAGETDQDGQAPDLQRVHKRIQDIVGVLRDFGAQREEGRSRAEYLSRLQKDLATYYSYGDFLLSKLMELFPLSELIEFLEANEVPRPITLRTNTLKTRRRDLAQLLINRGVNLDPLGKWSKSGLVVYDSSVPIGATPEYLAGHYMLQGASSMLPVMALAPQEHERILDMCCAPGGKTSYIAQLMKNTGVILANDANADRLKSVVGNLHRLGVTNTIISHYDGRQFPKVVGGFDRVLLDAPCSGTGVISKDPAVKTNKDEKDIQRCAHLQKELLLSAIDSVNAASKTGGYLVYCTCSITVEENEWVVDYALKKRNVRLVPTGLDFGQEGFTRFQARRFHPTLRSTRRFYPHTHNMDGFFIAKFKKFSNSIPQPHAGNSAAATPTEPDLKDQVTPKSENGSQPTKKARGAVKAKQQLLRQPHSKKPFQKLNGIAKGPGLSTEPSVPDAQVSTRPSQSAGNADVNSKRKRSEKLKQRGPKWKPSKEAAVPKPSAPSRVEDSGTPVPTPSEIRAAPRPKDCAPSLGKAKKKQKGKQQLAQQPANGAAPLKEDAVSKGPSAPFVSPHSSTRPPPAKRRKSMTKGNSQPLLS", "length": 793, "header": "sp|Q922K7-1|NOP2_MOUSE Isoform 1 of Probable 28S rRNA (cytosine-C(5))-methyltransferase OS=Mus musculus OX=10090 GN=Nop2 PE=1 SV=1 CANONICAL=Q922K7-1" }, "isoforms": [ { "isoform_ac": "A0A0N4SW16-1", "url": "", "sequence": { "sequence": "MGRKLDPTKKEKRGPGRKARKQKGAETELVRFLPAAGDENSKRLSSRARKRAAKRRAGSVDVPKPNKSPGIKTLPGELSKGAVQARGKKRPAPIQNSDGDEEEDSGEDDVVTQGDLWGSEDSDEDMVDDYGAA", "length": 133, "header": "tr|A0A0N4SW16-1|NOP2_MOUSE Computationally mapped isoform of Probable 28S rRNA (cytosine-C(5))-methyltransferase OS=Mus musculus OX=10090 GN=Nop2 PE=1 SV=1 CANONICAL=Q922K7-1" }, "locus": { "chromosome": "6", "start_pos": 125111667, "end_pos": 125109176, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000204185.2", "url": "https://www.ensembl.org/id/ENSMUST00000204185.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000145333.2", "url": "https://www.ensembl.org/id/ENSMUSP00000145333.2" } ] } }, { "isoform_ac": "E9QN31-1", "url": "", "sequence": { "sequence": "MGRKLDPTKKEKRGPGRKARKQKGAETELVRFLPAAGDENSKRLSSRARKRAAKRRAGSVDVPKPNKSPGIKTLPGELSKGAVQARGKKRPAPIQNSDGDEEEDSGEDDVVTQGDLWGSEDSDEDMVDDYGAASNSEDEEEKLLPIERAALKQKAQDATAGVLWNEEDTDEDEDDDGVSPESHPRKDDKAEGDLQINVEDEEAFVLPPAGETDQDGQAPDLQRVHKRIQDIVGVLRDFGAQREEGRSRAEYLSRLQKDLATYYSYGDFLLSKLMELFPLSELIEFLEANEVPRPITLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKSGLVVYDSSVPIGATPEYLAGHYMLQGASSMLPVMALAPQEHERILDMCCAPGGKTSYIAQLMKNTGVILANDANADRLKSVVGNLHRLGVTNTIISHYDGRQFPKVVGGFDRVLLDAPCSGTGVISKDPAVKTNKDEKDIQRCAHLQKELLLSAIDSVNAASKTGGYLVYCTCSITVEENEWVVDYALKKRNVRLVPTGLDFGQEGFTRFQARRFHPTLRSTRRFYPHTHNMDGFFIAKFKKFSNSIPQPHAGNSAAATPTEPDLKDQVTPKSENGSQPTKKARGAVKAKQQLLRQPHSKKPFQKLNGIAKGPGLSTEPSVPDAQVSTRPSQSAGNADVNSKRKRSEKLKQRGPKWKPSKEAAVPKPSAPSRVEDSRTPPVPTPSEIRAAPRPKDCAPSLGEAKKKQKGKQQLAQQPANGAAPLKEDAVSKGPSAPFVSPHSSTRPPPAKRRKSMTKGNSQPLLS", "length": 794, "header": "tr|E9QN31-1|NOP2_MOUSE Computationally mapped isoform of Probable 28S rRNA (cytosine-C(5))-methyltransferase OS=Mus musculus OX=10090 GN=Nop2 PE=1 SV=1 CANONICAL=Q922K7-1" }, "locus": { "chromosome": "6", "start_pos": 125121601, "end_pos": 125109176, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000044200.11", "url": "https://www.ensembl.org/id/ENSMUST00000044200.11" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000047123.9", "url": "https://www.ensembl.org/id/ENSMUSP00000047123.9" } ] } }, { "isoform_ac": "Q922K7-1", "url": "", "sequence": { "sequence": "MGRKLDPTKKEKRGPGRKARKQKGAETELVRFLPAAGDENSKRLSSRARKRAAKRRAGSVDVPKPNKSPGIKTLPGELSKGAVQARGKKRPAPIQNSDGDEEEDSGEDDVVTQGDLWGSEDSDEDMVDDYGAASNSEDEEEKLLPIERAALKQKAQDATAGVLWNEEDTDEDEDDDGVSPESHPRKDDKAEGDLQINVEDEEAFVLPPAGETDQDGQAPDLQRVHKRIQDIVGVLRDFGAQREEGRSRAEYLSRLQKDLATYYSYGDFLLSKLMELFPLSELIEFLEANEVPRPITLRTNTLKTRRRDLAQLLINRGVNLDPLGKWSKSGLVVYDSSVPIGATPEYLAGHYMLQGASSMLPVMALAPQEHERILDMCCAPGGKTSYIAQLMKNTGVILANDANADRLKSVVGNLHRLGVTNTIISHYDGRQFPKVVGGFDRVLLDAPCSGTGVISKDPAVKTNKDEKDIQRCAHLQKELLLSAIDSVNAASKTGGYLVYCTCSITVEENEWVVDYALKKRNVRLVPTGLDFGQEGFTRFQARRFHPTLRSTRRFYPHTHNMDGFFIAKFKKFSNSIPQPHAGNSAAATPTEPDLKDQVTPKSENGSQPTKKARGAVKAKQQLLRQPHSKKPFQKLNGIAKGPGLSTEPSVPDAQVSTRPSQSAGNADVNSKRKRSEKLKQRGPKWKPSKEAAVPKPSAPSRVEDSGTPVPTPSEIRAAPRPKDCAPSLGKAKKKQKGKQQLAQQPANGAAPLKEDAVSKGPSAPFVSPHSSTRPPPAKRRKSMTKGNSQPLLS", "length": 793, "header": "sp|Q922K7-1|NOP2_MOUSE Isoform 1 of Probable 28S rRNA (cytosine-C(5))-methyltransferase OS=Mus musculus OX=10090 GN=Nop2 PE=1 SV=1 CANONICAL=Q922K7-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q922K7", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q922K7" }, { "id": "34887587", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34887587" } ] } ], "phosphorylation": [ { "start_pos": 169, "end_pos": 169, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q922K7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q922K7" } ], "site_lbl": "Thr169" }, { "start_pos": 179, "end_pos": 179, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q922K7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q922K7" } ], "site_lbl": "Ser179" }, { "start_pos": 59, "end_pos": 59, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "site_lbl": "Ser59" }, { "start_pos": 649, "end_pos": 649, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "site_lbl": "Ser649" }, { "start_pos": 68, "end_pos": 68, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "site_lbl": "Ser68" }, { "start_pos": 713, "end_pos": 713, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "site_lbl": "Ser713" }, { "start_pos": 767, "end_pos": 767, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "site_lbl": "Ser767" }, { "start_pos": 782, "end_pos": 782, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "site_lbl": "Ser782" }, { "start_pos": 793, "end_pos": 793, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "site_lbl": "Ser793" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "A region of antisense RNA from human p120 cDNA with high homology to mouse p120 cDNA inhibits NIH 3T3 proliferation.", "journal": "Cancer Res.", "date": "1992", "authors": "Henning D., Valdez B.C., Zhu C., Busch H., Busch R.K., Perlaky L., Zhang W.W., Saijo Y.", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "reference": [ { "type": "PubMed", "id": "1394192", "url": "https://glygen.org/publication/PubMed/1394192" } ] }, { "title": "p120 nucleolar-proliferating antigen is a direct target of G-CSF signaling during myeloid differentiation.", "journal": "Journal of leukocyte biology", "date": "2006", "authors": "Khanna-Gupta A, Sun H, Zibello T, Lozovatsky L, Ghosh PK, Link DC, McLemore ML, Berliner N", "evidence": [ { "database": "RefSeq", "id": "NP_620086", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620086" } ], "reference": [ { "type": "PubMed", "id": "16641140", "url": "https://glygen.org/publication/PubMed/16641140" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" }, { "database": "iPTMnet", "id": "Q922K7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q922K7" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "Citrullination regulates pluripotency and histone H1 binding to chromatin.", "journal": "Nature", "date": "2014", "authors": "Christophorou MA, Castelo-Branco G, Halley-Stott RP, Oliveira CS, Loos R, Radzisheuskaya A, Mowen KA, Bertone P, Silva JC, Zernicka-Goetz M, Nielsen ML, Gurdon JB, Kouzarides T", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "reference": [ { "type": "PubMed", "id": "24463520", "url": "https://glygen.org/publication/PubMed/24463520" } ] }, { "title": "Nop2 is expressed during proliferation of neural stem cells and in adult mouse and human brain.", "journal": "Brain research", "date": "2015", "authors": "Kosi N, Alic I, Kolacevic M, Vrsaljko N, Jovanov Milosevic N, Sobol M, Philimonenko A, Hozak P, Gajovic S, Pochet R, Mitrecic D", "evidence": [ { "database": "RefSeq", "id": "NP_620086", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620086" } ], "reference": [ { "type": "PubMed", "id": "25481415", "url": "https://glygen.org/publication/PubMed/25481415" } ] }, { "title": "Nop2 is required for mammalian preimplantation development.", "journal": "Molecular reproduction and development", "date": "2016", "authors": "Cui W, Pizzollo J, Han Z, Marcho C, Zhang K, Mager J", "evidence": [ { "database": "RefSeq", "id": "NP_620086", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620086" } ], "reference": [ { "type": "PubMed", "id": "26632338", "url": "https://glygen.org/publication/PubMed/26632338" } ] }, { "title": "The nucleolar protein NOP2 is required for nucleolar maturation and ribosome biogenesis during preimplantation development in mammals.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2020", "authors": "Wang H, Wang L, Wang Z, Dang Y, Shi Y, Zhao P, Zhang K", "evidence": [ { "database": "RefSeq", "id": "NP_620086", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620086" } ], "reference": [ { "type": "PubMed", "id": "31908012", "url": "https://glygen.org/publication/PubMed/31908012" } ] }, { "title": "Dynamic eIF3a O-GlcNAcylation controls translation reinitiation during nutrient stress.", "journal": "Nature chemical biology", "date": "2022", "authors": "Shu XE, Mao Y, Jia L, Qian SB", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q922K7", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q922K7" } ], "reference": [ { "type": "PubMed", "id": "34887587", "url": "https://glygen.org/publication/PubMed/34887587" } ] } ], "pathway": [ { "id": "mmu:110109", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:110109", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P46087-1", "protein_name": "Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase", "gene_name": "NOP2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGRKLDPTKEKRGPGRKARKQKGAETELVRFLPAVSDENSKRLSSRARKRAAKRRLGSVEAPKTNKSPEAKPLPGKLPKGISAGAVQTAGKKGPQSLFNAPRGKKRPAPGSDEEEEEEDSEEDGMVNHGDLWGSEDDADTVDDYGADSNSEDEEEGEALLPIERAARKQKAREAAAGIQWSEEETEDEEEEKEVTPESGPPKVEEADGGLQINVDEEPFVLPPAGEMEQDAQAPDLQRVHKRIQDIVGILRDFGAQREEGRSRSEYLNRLKKDLAIYYSYGDFLLGKLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGHYMLQGASSMLPVMALAPQEHERILDMCCAPGGKTSYMAQLMKNTGVILANDANAERLKSVVGNLHRLGVTNTIISHYDGRQFPKVVGGFDRVLLDAPCSGTGVISKDPAVKTNKDEKDILRCAHLQKELLLSAIDSVNATSKTGGYLVYCTCSITVEENEWVVDYALKKRNVRLVPTGLDFGQEGFTRFRERRFHPSLRSTRRFYPHTHNMDGFFIAKFKKFSNSIPQSQTGNSETATPTNVDLPQVIPKSENSSQPAKKAKGAAKTKQQLQKQQHPKKASFQKLNGISKGADSELSTVPSVTKTQASSSFQDSSQPAGKAEGIREPKVTGKLKQRSPKLQSSKKVAFLRQNAPPKGTDTQTPAVLSPSKTQATLKPKDHHQPLGRAKGVEKQQLPEQPFEKAAFQKQNDTPKGPQPPTVSPIRSSRPPPAKRKKSQSRGNSQLLLS", "length": 812 }, "evidence": [ { "id": "45227047", "url": "http://www.informatics.jax.org/homology/45227047", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "pmid": "" }, { "name": "S-adenosylmethionine-dependent methyltransferase activity", "id": "GO:0008757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008757", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "pmid": "" }, { "name": "rRNA (cytosine-C5-)-methyltransferase activity", "id": "GO:0009383", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009383", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "RNA processing", "id": "GO:0006396", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006396", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "pmid": "" }, { "name": "regulation of signal transduction by p53 class mediator", "id": "GO:1901796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901796", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "pmid": "" }, { "name": "ribosomal large subunit assembly", "id": "GO:0000027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000027", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "pmid": "" }, { "name": "RNA methylation", "id": "GO:0001510", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001510", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "pmid": "" }, { "name": "blastocyst formation", "id": "GO:0001825", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001825", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "pmid": "" }, { "name": "rRNA base methylation", "id": "GO:0070475", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070475", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "pmid": "" }, { "name": "maturation of LSU-rRNA", "id": "GO:0000470", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000470", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 604, "end_pos": 606, "annotation": "n_glycosylation_sequon" }, { "start_pos": 66, "end_pos": 68, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Citrullinated by PADI4.", "evidence": [ { "database": "UniProtKB", "id": "Q922K7", "url": "https://www.uniprot.org/uniprot/Q922K7" }, { "database": "PubMed", "id": "24463520", "url": "https://glygen.org/publication/PubMed/24463520" } ] } ], "interactions": [], "reactions": [ { "id": "47788", "name": "", "equation": "a cytidine in 28S rRNA + S-adenosyl-L-methionine = a 5-methylcytidine in 28S rRNA + H(+) + S-adenosyl-L-homocysteine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q922K7-1", "Q8K4F6-1", "Q9VDZ4-1" ], "evidence": [ { "id": "47788", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/47788" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "Q8K4F6", "gene_name": "Nsun5", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q8K4F6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4F6" } ] } ] }, { "uniprot_ac": "Q922K7", "gene_name": "Nop2", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q922K7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922K7" } ] } ] }, { "uniprot_ac": "Q9VDZ4", "gene_name": "Nsun5", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q9VDZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VDZ4" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }