{ "uniprot_canonical_ac": "Q922B1-1", "uniprot_ac": "Q922B1", "uniprot_id": "MACD1_MOUSE", "mass": { "chemical_mass": 35295.0, "monoisotopic_mass": 35295.0 }, "refseq": { "ac": "NP_598908", "name": "ADP-ribose glycohydrolase MACROD1 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598908" }, "gene_names": [ { "name": "Macrod1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q922B1", "id": "Q922B1" }, { "name": "D930010J01Rik; Lrp16", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598908", "id": "NP_598908" }, { "name": "Lrp16", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q922B1", "id": "Q922B1" }, { "name": "Macrod1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598908", "id": "NP_598908" } ], "protein_names": [ { "name": "ADP-ribose glycohydrolase MACROD1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q922B1" }, { "name": "3.1.1.106", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q922B1" }, { "name": "3.2.2.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q922B1" }, { "name": "ADP-ribose glycohydrolase MACROD1 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598908", "id": "NP_598908" }, { "name": "MACRO domain-containing protein 1; O-acetyl-ADP-ribose deacetylase MACROD1; [Protein ADP-ribosylglutamate] hydrolase; [Protein ADP-ribosylaspartate] hydrolase MACROD1; [Protein ADP-ribosylglutamate] hydrolase MACROD1; ADP-ribose glycohydrolase MACROD1; MACRO domain containing 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598908", "id": "NP_598908" }, { "name": "MACRO domain-containing protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q922B1" }, { "name": "O-acetyl-ADP-ribose deacetylase MACROD1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q922B1" }, { "name": "Protein LRP16", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q922B1" }, { "name": "[Protein ADP-ribosylaspartate] hydrolase MACROD1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q922B1" }, { "name": "[Protein ADP-ribosylglutamate] hydrolase MACROD1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q922B1" } ], "function": [ { "annotation": "Behavioural Characterisation of Macrod1 and Macrod2 Knockout Mice. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_598908", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598908" }, { "database": "PubMed", "id": "33578760", "url": "https://glygen.org/publication/PubMed/33578760" } ] }, { "annotation": "LRP16 acts as a negative regulator of insulin action and adipogenesis in 3T3-L1 adipocytes.", "evidence": [ { "database": "RefSeq", "id": "NP_598908", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598908" }, { "database": "PubMed", "id": "23389992", "url": "https://glygen.org/publication/PubMed/23389992" } ] }, { "annotation": "LRP16 gene causes insulin resistance in C2-C12 cells by inhibiting the IRS-1 signaling and the transcriptional activity of PPARgamma.", "evidence": [ { "database": "RefSeq", "id": "NP_598908", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598908" }, { "database": "PubMed", "id": "21756814", "url": "https://glygen.org/publication/PubMed/21756814" } ] }, { "annotation": "LRP16 played important roles not only in insulin content and GSIS but also in the antilipotoxic effect mediated by Akt/FoxO1 signaling.", "evidence": [ { "database": "RefSeq", "id": "NP_598908", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598908" }, { "database": "PubMed", "id": "22800886", "url": "https://glygen.org/publication/PubMed/22800886" } ] }, { "annotation": "Removes ADP-ribose from aspartate and glutamate residues in proteins bearing a single ADP-ribose moiety. Inactive towards proteins bearing poly-ADP-ribose. Deacetylates O-acetyl-ADP ribose, a signaling molecule generated by the deacetylation of acetylated lysine residues in histones and other proteins. Plays a role in estrogen signaling. Binds to androgen receptor (AR) and amplifies the transactivation function of AR in response to androgen. May play an important role in carcinogenesis and/or progression of hormone-dependent cancers by feed-forward mechanism that activates ESR1 transactivation. Could be an ESR1 coactivator, providing a positive feedback regulatory loop for ESR1 signal transduction. Could be involved in invasive growth by down-regulating CDH1 in endometrial cancer cells. Enhances ESR1-mediated transcription activity.", "evidence": [ { "database": "UniProtKB", "id": "Q922B1", "url": "https://www.uniprot.org/uniprot/Q922B1#function" }, { "database": "UniProtKB", "id": "Q9BQ69", "url": "https://www.uniprot.org/uniprot/Q9BQ69#function" } ] }, { "annotation": "These results suggest that LRP16 plays a key role in maintaining pancreatic beta-cell functions and may help us to understand the protective effects of estrogen on the functions of pancreatic beta-cells.", "evidence": [ { "database": "RefSeq", "id": "NP_598908", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598908" }, { "database": "PubMed", "id": "22528219", "url": "https://glygen.org/publication/PubMed/22528219" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q922B1", "url": "https://www.uniprot.org/uniprot/Q922B1" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Macrod1", "url": "https://www.uniprot.org/uniprot/Q922B1", "locus": { "chromosome": "19", "start_pos": 7175422, "end_pos": 7034178, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000036278", "url": "https://www.ensembl.org/id/ENSMUSG00000036278" } ] } } ], "crossref": [ { "id": "ENSMUSG00000036278", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000036278", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "3.1.1.106", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.1.1.106&UniProtAcc=Q922B1", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd02908", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02908", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "107227", "url": "https://www.ncbi.nlm.nih.gov/gene/107227", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q922B1", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q922B1*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002589", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002589", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043472", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043472", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:107227", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:107227", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2147583", "url": "http://www.informatics.jax.org/marker/MGI:2147583", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q922B1", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q922B1", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PIVHGEP", "url": "https://omabrowser.org/oma/group/PIVHGEP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1105329at2759", "url": "http://www.orthodb.org/?query=1105329at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11106", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11106", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11106:SF93", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11106:SF93", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01661", "url": "http://pfam.xfam.org/family/PF01661", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q922B1", "url": "http://purl.obolibrary.org/obo/PR_Q922B1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_598908", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598908", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "54428", "url": "https://www.rhea-db.org/rhea/54428", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "57060", "url": "https://www.rhea-db.org/rhea/57060", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "58248", "url": "https://www.rhea-db.org/rhea/58248", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "59244", "url": "https://www.rhea-db.org/rhea/59244", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "68792", "url": "https://www.rhea-db.org/rhea/68792", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q922B1", "url": "https://www.uniprot.org/uniprot/Q922B1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q922B1-1", "url": "https://www.uniprot.org/uniprot/Q922B1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSLQSQVSGRLAQLRAAGQLLVSLRPWPGRSAGGPRPRGSACGPLVALGEHGYCAWLSAGVGAWGAAGRGAWVRTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFIKLKKIPTWKETAKGLAVKVEDPKYKKDKQLNEKISLYRGDITKLEVDAIVNAANSSLLGGGGVDGCIHRAAGSLLTDECRTLQNCETGKAKITCGYRLPAKYVIHTVGPIAVGQPTASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPNEEAAEVVLASLREWLEQHKDKVDRLIICVFLEKDEGIYRERLPHYFPVA", "length": 323, "header": "sp|Q922B1-1|MACD1_MOUSE Isoform 1 of ADP-ribose glycohydrolase MACROD1 OS=Mus musculus OX=10090 GN=Macrod1 PE=1 SV=2 CANONICAL=Q922B1-1" }, "isoforms": [ { "isoform_ac": "Q922B1-1", "url": "", "sequence": { "sequence": "MSLQSQVSGRLAQLRAAGQLLVSLRPWPGRSAGGPRPRGSACGPLVALGEHGYCAWLSAGVGAWGAAGRGAWVRTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFIKLKKIPTWKETAKGLAVKVEDPKYKKDKQLNEKISLYRGDITKLEVDAIVNAANSSLLGGGGVDGCIHRAAGSLLTDECRTLQNCETGKAKITCGYRLPAKYVIHTVGPIAVGQPTASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPNEEAAEVVLASLREWLEQHKDKVDRLIICVFLEKDEGIYRERLPHYFPVA", "length": 323, "header": "sp|Q922B1-1|MACD1_MOUSE Isoform 1 of ADP-ribose glycohydrolase MACROD1 OS=Mus musculus OX=10090 GN=Macrod1 PE=1 SV=2 CANONICAL=Q922B1-1" }, "locus": { "chromosome": "19", "start_pos": 7175068, "end_pos": 7034259, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000040261", "url": "https://www.ensembl.org/id/ENSMUST00000040261" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000039507", "url": "https://www.ensembl.org/id/ENSMUSP00000039507" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q922B1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q922B1" }, { "id": "36288343", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36288343" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "[LRP16 gene causes insulin resistance in C2-C12 cells by inhibiting the IRS-1 signaling and the transcriptional activity of peroxisome proliferator actived receptor gamma].", "journal": "Zhonghua yi xue za zhi", "date": "2011", "authors": "Zang L, Mu YM, Lu ZH, Xue B, Ma XL, Yang GQ, Ba JM, Dou JT, Lu JM", "evidence": [ { "database": "RefSeq", "id": "NP_598908", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598908" } ], "reference": [ { "type": "PubMed", "id": "21756814", "url": "https://glygen.org/publication/PubMed/21756814" } ] }, { "title": "Reduced expression of the LRP16 gene in mouse insulinoma (MIN6) cells exerts multiple effects on insulin content, proliferation and apoptosis.", "journal": "Journal of Huazhong University of Science and Technology. Medical sciences = Hua zhong ke ji da xue xue bao. Yi xue Ying De wen ban = Huazhong keji daxue xuebao. Yixue Yingdewen ban", "date": "2012", "authors": "Li X, Xue B, Wang X, Sun L, Zhang T, Qu L, Zou X, Mu Y", "evidence": [ { "database": "RefSeq", "id": "NP_598908", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598908" } ], "reference": [ { "type": "PubMed", "id": "22528219", "url": "https://glygen.org/publication/PubMed/22528219" } ] }, { "title": "LRP16 gene protects mouse insulinoma MIN6 cells against fatty acid-induced apoptosis through Akt/FoxO1 signaling.", "journal": "Chinese medical journal", "date": "2012", "authors": "Li XJ, Guo QH, Wang X, Xue B, Sun LQ, Meng QT, Lu JM, Mu YM", "evidence": [ { "database": "RefSeq", "id": "NP_598908", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598908" } ], "reference": [ { "type": "PubMed", "id": "22800886", "url": "https://glygen.org/publication/PubMed/22800886" } ] }, { "title": "Identification of LRP16 as a negative regulator of insulin action and adipogenesis in 3T3-L1 adipocytes.", "journal": "Hormone and metabolic research = Hormon- und Stoffwechselforschung = Hormones et metabolisme", "date": "2013", "authors": "Zang L, Xue B, Lu Z, Li X, Yang G, Guo Q, Ba J, Zou X, Dou J, Lu J, Pan C, Mu Y", "evidence": [ { "database": "RefSeq", "id": "NP_598908", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598908" } ], "reference": [ { "type": "PubMed", "id": "23389992", "url": "https://glygen.org/publication/PubMed/23389992" } ] }, { "title": "Label-free quantitative proteomics of the lysine acetylome in mitochondria identifies substrates of SIRT3 in metabolic pathways.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2013", "authors": "Rardin MJ, Newman JC, Held JM, Cusack MP, Sorensen DJ, Li B, Schilling B, Mooney SD, Kahn CR, Verdin E, Gibson BW", "evidence": [ { "database": "UniProtKB", "id": "Q922B1", "url": "https://www.uniprot.org/uniprot/Q922B1" } ], "reference": [ { "type": "PubMed", "id": "23576753", "url": "https://glygen.org/publication/PubMed/23576753" } ] }, { "title": "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.", "journal": "Mol. Cell", "date": "2013", "authors": "Park J, Chen Y, Tishkoff DX, Peng C, Tan M, Dai L, Xie Z, Zhang Y, Zwaans BM, Skinner ME, Lombard DB, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "Q922B1", "url": "https://www.uniprot.org/uniprot/Q922B1" } ], "reference": [ { "type": "PubMed", "id": "23806337", "url": "https://glygen.org/publication/PubMed/23806337" } ] }, { "title": "Behavioural Characterisation of Macrod1 and Macrod2 Knockout Mice.", "journal": "Cells", "date": "2021", "authors": "Crawford K, Oliver PL, Agnew T, Hunn BHM, Ahel I", "evidence": [ { "database": "RefSeq", "id": "NP_598908", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598908" } ], "reference": [ { "type": "PubMed", "id": "33578760", "url": "https://glygen.org/publication/PubMed/33578760" } ] }, { "title": "First comprehensive identification of cardiac proteins with putative increased O-GlcNAc levels during pressure overload hypertrophy.", "journal": "PloS one", "date": "2022", "authors": "Zhu Wei Zhong, Palazzo Teresa, Zhou Mowei, Ledee Dolena, Olson Heather M, Pa\u0161a-Toli\u0107 Ljiljana, Olson Aaron K", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q922B1", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q922B1" } ], "reference": [ { "type": "PubMed", "id": "36288343", "url": "https://glygen.org/publication/PubMed/36288343" } ] } ], "pathway": [ { "id": "mmu:107227", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:107227", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8K4G6-1", "protein_name": "ADP-ribose glycohydrolase MACROD1", "gene_name": "Macrod1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "AAGRGAWVRTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFIKLKKIPMWKETAKGLAGKVENPKYKKDKQLNEKISLFRGDITKLEVDAIVNAANNSLLGGGGVDGCIHRAAGSLLTDECRTLQNCETGKAKITCGYRLPAKHVIHTVGPIAVGQPTASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPNEEAAEVVLATLREWLEQHKDKVDRLIICVFLEKDEGIYQERLPHYFPVA", "length": 258 }, "evidence": [ { "id": "45233095", "url": "http://www.informatics.jax.org/homology/45233095", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9BQ69-1", "protein_name": "ADP-ribose glycohydrolase MACROD1", "gene_name": "MACROD1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSLQSRLSGRLAQLRAAGQLLVPPRPRPGHLAGATRTRSSTCGPPAFLGVFGRRARTSAGVGAWGAAAVGRTAGVRTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVAVKVEEPRYKKDKQLNEKISLLRSDITKLEVDAIVNAANSSLLGGGGVDGCIHRAAGPLLTDECRTLQSCKTGKAKITGGYRLPAKYVIHTVGPIAYGEPSASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPCEAAAEIVLATLREWLEQHKDKVDRLIICVFLEKDEDIYRSRLPHYFPVA", "length": 325 }, "evidence": [ { "id": "45233095", "url": "http://www.informatics.jax.org/homology/45233095", "database": "MGI" }, { "id": "Q922B1", "url": "https://omabrowser.org/oma/group/Q922B1/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q922B1", "url": "https://www.uniprot.org/uniprot/Q922B1" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q922B1", "url": "https://www.uniprot.org/uniprot/Q922B1" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q922B1", "url": "https://www.uniprot.org/uniprot/Q922B1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "DNA damage response", "id": "GO:0006974", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006974", "evidence": [ { "database": "UniProtKB", "id": "Q922B1", "url": "https://www.uniprot.org/uniprot/Q922B1" } ], "pmid": "" }, { "name": "protein de-ADP-ribosylation", "id": "GO:0051725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051725", "evidence": [ { "database": "UniProtKB", "id": "Q922B1", "url": "https://www.uniprot.org/uniprot/Q922B1" } ], "pmid": "" }, { "name": "purine nucleoside metabolic process", "id": "GO:0042278", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042278", "evidence": [ { "database": "UniProtKB", "id": "Q922B1", "url": "https://www.uniprot.org/uniprot/Q922B1" } ], "pmid": "" }, { "name": "peptidyl-glutamate ADP-deribosylation", "id": "GO:0140291", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140291", "evidence": [ { "database": "UniProtKB", "id": "Q922B1", "url": "https://www.uniprot.org/uniprot/Q922B1" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "deacetylase activity", "id": "GO:0019213", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019213", "evidence": [ { "database": "UniProtKB", "id": "Q922B1", "url": "https://www.uniprot.org/uniprot/Q922B1" } ], "pmid": "" }, { "name": "hydrolase activity, acting on glycosyl bonds", "id": "GO:0016798", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016798", "evidence": [ { "database": "UniProtKB", "id": "Q922B1", "url": "https://www.uniprot.org/uniprot/Q922B1" } ], "pmid": "" }, { "name": "ADP-ribosylglutamate hydrolase activity", "id": "GO:0140293", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140293", "evidence": [ { "database": "UniProtKB", "id": "Q922B1", "url": "https://www.uniprot.org/uniprot/Q922B1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 172, "end_pos": 174, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "54428", "name": "", "equation": "4-O-(ADP-D-ribosyl)-L-aspartyl-[protein] + H2O = ADP-D-ribose + H(+) + L-aspartyl-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8K4G6-1", "Q9BQ69-1", "A1Z1Q3-2", "Q922B1-1", "Q3UYG8-1" ], "evidence": [ { "id": "54428", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/54428" } ] }, { "id": "57060", "name": "", "equation": "2''-O-acetyl-ADP-D-ribose + H2O = acetate + ADP-D-ribose + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8K4G6-1", "Q9Y530-1", "Q9BQ69-1", "A1Z1Q3-2", "Q922B1-1", "Q3UYG8-1", "Q8R5F3-1" ], "evidence": [ { "id": "57060", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/57060" } ] }, { "id": "58248", "name": "", "equation": "5-O-(ADP-D-ribosyl)-L-glutamyl-[protein] + H2O = ADP-D-ribose + H(+) + L-glutamyl-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8K4G6-1", "Q9Y530-1", "Q9BQ69-1", "A1Z1Q3-2", "Q922B1-1", "Q3UYG8-1", "Q8R5F3-1" ], "evidence": [ { "id": "58248", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/58248" } ] }, { "id": "59244", "name": "", "equation": "3''-O-acetyl-ADP-D-ribose + H2O = acetate + ADP-D-ribose + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8K4G6-1", "Q9BQ69-1", "Q922B1-1" ], "evidence": [ { "id": "59244", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/59244" } ] }, { "id": "68792", "name": "", "equation": "alpha-NAD(+) + H2O = ADP-D-ribose + H(+) + nicotinamide", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q02589-1", "Q8K4G6-1", "Q9NX46-1", "P54922-1", "Q9Y530-1", "Q9BQ69-1", "A1Z1Q3-2", "Q922B1-1", "Q8CG72-1", "P54923-1", "Q8R5F3-1", "Q3UYG8-1" ], "evidence": [ { "id": "68792", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/68792" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A1Z1Q3", "gene_name": "MACROD2", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "A1Z1Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z1Q3" } ] }, { "ec_number": "3.2.2.-", "activity": "", "evidence": [ { "id": "A1Z1Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z1Q3" } ] } ] }, { "uniprot_ac": "P54922", "gene_name": "ADPRH", "activity": [ { "ec_number": "3.2.2.19", "activity": "H2O + N(omega)-(ADP-D-ribosyl)-L-arginyl-[protein] = ADP-D-ribose + L-arginyl-[protein].", "evidence": [ { "id": "P54922", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54922" } ] }, { "ec_number": "3.2.2.19", "activity": "", "evidence": [ { "id": "P54922", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54922" } ] } ] }, { "uniprot_ac": "P54923", "gene_name": "Adprh", "activity": [ { "ec_number": "3.2.2.19", "activity": "H2O + N(omega)-(ADP-D-ribosyl)-L-arginyl-[protein] = ADP-D-ribose + L-arginyl-[protein].", "evidence": [ { "id": "P54923", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54923" } ] }, { "ec_number": "3.2.2.19", "activity": "", "evidence": [ { "id": "P54923", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54923" } ] } ] }, { "uniprot_ac": "Q02589", "gene_name": "Adprh", "activity": [ { "ec_number": "3.2.2.19", "activity": "H2O + N(omega)-(ADP-D-ribosyl)-L-arginyl-[protein] = ADP-D-ribose + L-arginyl-[protein].", "evidence": [ { "id": "Q02589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02589" } ] }, { "ec_number": "3.2.2.19", "activity": "", "evidence": [ { "id": "Q02589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02589" } ] } ] }, { "uniprot_ac": "Q3UYG8", "gene_name": "Macrod2", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q3UYG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UYG8" } ] }, { "ec_number": "3.2.2.-", "activity": "", "evidence": [ { "id": "Q3UYG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UYG8" } ] } ] }, { "uniprot_ac": "Q8CG72", "gene_name": "Adprs", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q8CG72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CG72" } ] }, { "ec_number": "3.2.1.143", "activity": "[(1''->2')-ADP-alpha-D-ribose](n) + H2O = [(1''->2')-ADP-alpha-D-ribose](n-1) + ADP-D-ribose.", "evidence": [ { "id": "Q8CG72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CG72" } ] }, { "ec_number": "3.2.2.-", "activity": "", "evidence": [ { "id": "Q8CG72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CG72" } ] } ] }, { "uniprot_ac": "Q8K4G6", "gene_name": "Macrod1", "activity": [ { "ec_number": "3.2.2.-", "activity": "", "evidence": [ { "id": "Q8K4G6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4G6" } ] }, { "ec_number": "3.1.1.106", "activity": "2''-O-acetyl-ADP-D-ribose + H2O = acetate + ADP-D-ribose + H(+).", "evidence": [ { "id": "Q8K4G6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4G6" } ] } ] }, { "uniprot_ac": "Q8R5F3", "gene_name": "Oard1", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q8R5F3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5F3" } ] }, { "ec_number": "3.2.2.-", "activity": "", "evidence": [ { "id": "Q8R5F3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5F3" } ] } ] }, { "uniprot_ac": "Q922B1", "gene_name": "Macrod1", "activity": [ { "ec_number": "3.2.2.-", "activity": "", "evidence": [ { "id": "Q922B1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922B1" } ] }, { "ec_number": "3.1.1.106", "activity": "2''-O-acetyl-ADP-D-ribose + H2O = acetate + ADP-D-ribose + H(+).", "evidence": [ { "id": "Q922B1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922B1" } ] } ] }, { "uniprot_ac": "Q9BQ69", "gene_name": "MACROD1", "activity": [ { "ec_number": "3.2.2.-", "activity": "", "evidence": [ { "id": "Q9BQ69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BQ69" } ] }, { "ec_number": "3.1.1.106", "activity": "2''-O-acetyl-ADP-D-ribose + H2O = acetate + ADP-D-ribose + H(+).", "evidence": [ { "id": "Q9BQ69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BQ69" } ] } ] }, { "uniprot_ac": "Q9NX46", "gene_name": "ADPRS", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q9NX46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NX46" } ] }, { "ec_number": "3.2.1.143", "activity": "[(1''->2')-ADP-alpha-D-ribose](n) + H2O = [(1''->2')-ADP-alpha-D-ribose](n-1) + ADP-D-ribose.", "evidence": [ { "id": "Q9NX46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NX46" } ] }, { "ec_number": "3.2.2.-", "activity": "", "evidence": [ { "id": "Q9NX46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NX46" } ] } ] }, { "uniprot_ac": "Q9Y530", "gene_name": "OARD1", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q9Y530", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y530" } ] }, { "ec_number": "3.2.2.-", "activity": "", "evidence": [ { "id": "Q9Y530", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y530" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }