{ "uniprot_canonical_ac": "Q91ZN5-1", "uniprot_ac": "Q91ZN5", "uniprot_id": "S35B2_MOUSE", "mass": { "chemical_mass": 47370.0, "monoisotopic_mass": 47370.0 }, "refseq": {}, "gene_names": [ { "name": "Slc35b2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q91ZN5", "id": "Q91ZN5" }, { "name": "J207", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q91ZN5", "id": "Q91ZN5" }, { "name": "Slc35b1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q91ZN5", "id": "Q91ZN5" } ], "protein_names": [ { "name": "Adenosine 3'-phospho 5'-phosphosulfate transporter 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q91ZN5" }, { "name": "Solute carrier family 35 member B2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91ZN5" } ], "function": [ { "annotation": "Probably functions as a 3'-phosphoadenylyl sulfate:adenosine 3',5'-bisphosphate antiporter at the Golgi membranes. Mediates the transport from the cytosol into the lumen of the Golgi of 3'-phosphoadenylyl sulfate/adenosine 3'-phospho 5'-phosphosulfate (PAPS), a universal sulfuryl donor for sulfation events that take place in that compartment.", "evidence": [ { "database": "UniProtKB", "id": "Q91ZN5", "url": "https://www.uniprot.org/uniprot/Q91ZN5#function" }, { "database": "UniProtKB", "id": "Q8TB61", "url": "https://www.uniprot.org/uniprot/Q8TB61#function" } ] } ], "disease": [ { "disease_id": "DOID:0070403", "recommended_name": { "id": "DOID:0070403", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070403", "name": "hypomyelinating leukodystrophy 26", "description": "A hypomyelinating leukodystrophy characterized by severe psychomotor delay, predominantly involving motor and expressive language development, cerebral and cerebellar atrophy, and corpus callosum hypoplasia that has_material_basis_in homozygous mutation in the SLC35B2 gene on chromosome 6p21." }, "synonyms": [ { "id": "DOID:0070403", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070403", "name": "HLD26", "description": "" }, { "id": "MONDO:0859518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0859518", "name": "leukodystrophy, hypomyelinating, 26, with chondrodysplasia", "description": "" }, { "id": "MIM:620269", "resource": "MIM", "url": "https://www.omim.org/entry/620269", "name": "Leukodystrophy, hypomyelinating, 26, with chondrodysplasia", "description": "Leukodystrophy, hypomyelinating, 26, with chondrodysplasia" } ], "evidence": [ { "id": "0070403", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0070403" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q91ZN5", "url": "https://www.uniprot.org/uniprot/Q91ZN5" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Slc35b2", "url": "https://www.uniprot.org/uniprot/Q91ZN5", "locus": { "chromosome": "17", "start_pos": 45878597, "end_pos": 45874800, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000037089", "url": "https://www.ensembl.org/id/ENSMUSG00000037089" } ] } } ], "crossref": [ { "id": "ENSMUSG00000037089", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000037089", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR013657", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013657", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "1921086", "url": "http://www.informatics.jax.org/marker/MGI:1921086", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "KIMTQHY", "url": "https://omabrowser.org/oma/group/KIMTQHY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1445334at2759", "url": "http://www.orthodb.org/?query=1445334at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10778", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10778", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10778:SF13", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10778:SF13", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF08449", "url": "http://pfam.xfam.org/family/PF08449", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q91ZN5", "url": "http://purl.obolibrary.org/obo/PR_Q91ZN5", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-174362", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174362", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-727802", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-727802", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_006525059", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006525059", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "76063", "url": "https://www.rhea-db.org/rhea/76063", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A286YE16", "url": "https://www.uniprot.org/uniprot/A0A286YE16", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A286YE16-1", "url": "https://www.uniprot.org/uniprot/A0A286YE16-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q91ZN5", "url": "https://www.uniprot.org/uniprot/Q91ZN5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q91ZN5-1", "url": "https://www.uniprot.org/uniprot/Q91ZN5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q91ZN5-2", "url": "https://www.uniprot.org/uniprot/Q91ZN5-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D1L5", "url": "https://www.uniprot.org/uniprot/Q9D1L5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D1L5-1", "url": "https://www.uniprot.org/uniprot/Q9D1L5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDARWWAVVVLATLPSLGAGGESPEAPPQSWTQLWLFRFLLNVAGYASFMVPGYLLVQYLRRKNYLETGRGLCFPLVKACVFGNEPKAPDEVLLAPRTETAESTPSWQVLKLVFCASGLQVSYLTWGILQERVMTGSYGATATSPGEHFTDSQFLVLMNRVLALVVAGLYCVLRKQPRHGAPMYRYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMMMGKLVSRRSYEHWEYLTAGLISIGVSMFLLSSGPEPRSSPATTLSGLVLLAGYIAFDSFTSNWQDALFAYKMSSVQMMFGVNLFSCLFTVGSLLEQGALLEGARFMGRHSEFALHALLLSICSAFGQLFIFYTIGQFGAAVFTIIMTLRQAIAILLSCLLYGHTVTVVGGLGVAVVFTALLLRVYARGRKQRGKKAVPTEPPVQKV", "length": 431, "header": "sp|Q91ZN5-1|S35B2_MOUSE Isoform 1 of Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Mus musculus OX=10090 GN=Slc35b2 PE=1 SV=1 CANONICAL=Q91ZN5-1" }, "isoforms": [ { "isoform_ac": "A0A286YE16-1", "url": "", "sequence": { "sequence": "XQYLRRKNYLETGRGLCFPLVKACVFGNEPKAPDEVLLAPRTETAESTPSWQVLKLVFCASGLQDTAQS", "length": 69, "header": "tr|A0A286YE16-1|A0A286YE16_MOUSE Computationally mapped isoform of Solute carrier family 35, member B2 OS=Mus musculus OX=10090 GN=Slc35b2 PE=1 SV=1 CANONICAL=Q91ZN5-1" }, "locus": { "chromosome": "17", "start_pos": 45876142, "end_pos": 45875665, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000224341.2", "url": "https://www.ensembl.org/id/ENSMUST00000224341.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000153676.2", "url": "https://www.ensembl.org/id/ENSMUSP00000153676.2" } ] } }, { "isoform_ac": "Q91ZN5-1", "url": "", "sequence": { "sequence": "MDARWWAVVVLATLPSLGAGGESPEAPPQSWTQLWLFRFLLNVAGYASFMVPGYLLVQYLRRKNYLETGRGLCFPLVKACVFGNEPKAPDEVLLAPRTETAESTPSWQVLKLVFCASGLQVSYLTWGILQERVMTGSYGATATSPGEHFTDSQFLVLMNRVLALVVAGLYCVLRKQPRHGAPMYRYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMMMGKLVSRRSYEHWEYLTAGLISIGVSMFLLSSGPEPRSSPATTLSGLVLLAGYIAFDSFTSNWQDALFAYKMSSVQMMFGVNLFSCLFTVGSLLEQGALLEGARFMGRHSEFALHALLLSICSAFGQLFIFYTIGQFGAAVFTIIMTLRQAIAILLSCLLYGHTVTVVGGLGVAVVFTALLLRVYARGRKQRGKKAVPTEPPVQKV", "length": 431, "header": "sp|Q91ZN5-1|S35B2_MOUSE Isoform 1 of Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Mus musculus OX=10090 GN=Slc35b2 PE=1 SV=1 CANONICAL=Q91ZN5-1" }, "locus": { "chromosome": "17", "start_pos": 45878167, "end_pos": 45874984, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000224905", "url": "https://www.ensembl.org/id/ENSMUST00000224905" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000153367", "url": "https://www.ensembl.org/id/ENSMUSP00000153367" } ] } }, { "isoform_ac": "Q91ZN5-2", "url": "", "sequence": { "sequence": "MVPGYLLVQYLRRKNYLETGRGLCFPLVKACVFGNEPKAPDEVLLAPRTETAESTPSWQVLKLVFCASGLQVSYLTWGILQERVMTGSYGATATSPGEHFTDSQFLVLMNRVLALVVAGLYCVLRKQPRHGAPMYRYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMMMGKLVSRRSYEHWEYLTAGLISIGVSMFLLSSGPEPRSSPATTLSGLVLLAGYIAFDSFTSNWQDALFAYKMSSVQMMFGVNLFSCLFTVGSLLEQGALLEGARFMGRHSEFALHALLLSICSAFGQLFIFYTIGQFGAAVFTIIMTLRQAIAILLSCLLYGHTVTVVGGLGVAVVFTALLLRVYARGRKQRGKKAVPTEPPVQKV", "length": 382, "header": "sp|Q91ZN5-2|S35B2_MOUSE Isoform 2 of Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Mus musculus OX=10090 GN=Slc35b2 PE=1 SV=1 CANONICAL=Q91ZN5-1" }, "locus": { "chromosome": "17", "start_pos": 45878167, "end_pos": 45875642, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000041353", "url": "https://www.ensembl.org/id/ENSMUST00000041353" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000037834", "url": "https://www.ensembl.org/id/ENSMUSP00000037834" } ] } }, { "isoform_ac": "Q9D1L5-1", "url": "", "sequence": { "sequence": "MDARWWAVVVLATLPSLGAGGESPEAPPQSWTQLWLFRFLLNVAGYASFMVPGYLLVQYLRRKNYLETGRGLCFPLVKACVFGNEPKAPDEVLLAPRTETAESTPSWQVLKLVFCASGLQTQFL", "length": 124, "header": "tr|Q9D1L5-1|S35B2_MOUSE Computationally mapped isoform of Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Mus musculus OX=10090 GN=Slc35b2 PE=1 SV=1 CANONICAL=Q91ZN5-1" }, "locus": { "chromosome": "17", "start_pos": 45876601, "end_pos": 45874984, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000226086.2", "url": "https://www.ensembl.org/id/ENSMUST00000226086.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000153497.2", "url": "https://www.ensembl.org/id/ENSMUSP00000153497.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "R-MMU-174362", "name": "Transport and synthesis of PAPS", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174362", "resource": "Reactome", "description": "Transport and synthesis of PAPS" }, { "id": "R-MMU-727802", "name": "Transport of nucleotide sugars", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-727802", "resource": "Reactome", "description": "Transport of nucleotide sugars" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8TB61-1", "protein_name": "Adenosine 3'-phospho 5'-phosphosulfate transporter 1", "gene_name": "SLC35B2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDARWWAVVVLAAFPSLGAGGETPEAPPESWTQLWFFRFVVNAAGYASFMVPGYLLVQYFRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETTPMWQALKLLFCATGLQVSYLTWGVLQERVMTRSYGATATSPGERFTDSQFLVLMNRVLALIVAGLSCVLCKQPRHGAPMYRYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMLMGKLVSRRSYEHWEYLTATLISIGVSMFLLSSGPEPRSSPATTLSGLILLAGYIAFDSFTSNWQDALFAYKMSSVQMMFGVNFFSCLFTVGSLLEQGALLEGTRFMGRHSEFAAHALLLSICSACGQLFIFYTIGQFGAAVFTIIMTLRQAFAILLSCLLYGHTVTVVGGLGVAVVFAALLLRVYARGRLKQRGKKAVPVESPVQKV", "length": 432 }, "evidence": [ { "id": "Q91ZN5", "url": "https://omabrowser.org/oma/group/Q91ZN5/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9VEI3-1", "protein_name": "Adenosine 3'-phospho 5'-phosphosulfate transporter 1", "gene_name": "sll", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MYAYNKMGRVPELVICSFIVVTLLVIHFFSDLLRASLGGYYNQDVTLSQLVESQNSDYAWFLKLLVNCFGYSCVFVPGFLIYKYVGRINYLERGNKTFLHKAINMCITGNSGYDQLDAGTSTADKDRPAASTAPKRTSSQEAVQLLWCFGGLMISYLTWGVLQEKIMTQNYLNFTGESAKFKDSQFLVFSNRLLAFLVALAYLQWQPSPVRHRAPLYKYSYASFSNIMSAWFQYEALKFVNFPTQVLAKSCKIIPVMLMGKIMSKAKYESYEYVTALLISLGMIFFMSGSSDSSKASGVTTLTGIFLLSMYMVFDSFTANWQGSLFKSYGMTPLQMMCGVNLFSSIFTGASLSMQGGFMDSLAFATEHPKFVFDMVVLSVCSAVGQLFIYHTIDVFGPVVFTIIMTLRQAVAIMLSCFIYQHSISLLGIFGVLIVFVAIFLRVYCTQRLRAIRKRAEANKPKMAV", "length": 465 }, "evidence": [ { "id": "Q91ZN5", "url": "https://omabrowser.org/oma/group/Q91ZN5/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "Q91ZN5", "url": "https://www.uniprot.org/uniprot/Q91ZN5" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "Q91ZN5", "url": "https://www.uniprot.org/uniprot/Q91ZN5" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q91ZN5", "url": "https://www.uniprot.org/uniprot/Q91ZN5" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "antiporter activity", "id": "GO:0015297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015297", "evidence": [ { "database": "UniProtKB", "id": "Q91ZN5", "url": "https://www.uniprot.org/uniprot/Q91ZN5" } ], "pmid": "" }, { "name": "3'-phosphoadenosine 5'-phosphosulfate transmembrane transporter activity", "id": "GO:0046964", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046964", "evidence": [ { "database": "UniProtKB", "id": "Q91ZN5", "url": "https://www.uniprot.org/uniprot/Q91ZN5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "3'-phosphoadenosine 5'-phosphosulfate transport", "id": "GO:0046963", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046963", "evidence": [ { "database": "UniProtKB", "id": "Q91ZN5", "url": "https://www.uniprot.org/uniprot/Q91ZN5" } ], "pmid": "" }, { "name": "chondroitin sulfate biosynthetic process", "id": "GO:0030206", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030206", "evidence": [ { "database": "UniProtKB", "id": "Q91ZN5", "url": "https://www.uniprot.org/uniprot/Q91ZN5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "76063", "name": "", "equation": "3'-phosphoadenylyl sulfate(in) + adenosine 3',5'-bisphosphate(out) = 3'-phosphoadenylyl sulfate(out) + adenosine 3',5'-bisphosphate(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "76063", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/76063" } ] } ], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }