{ "uniprot_canonical_ac": "Q91ZJ5-1", "uniprot_ac": "Q91ZJ5", "uniprot_id": "UGPA_MOUSE", "mass": { "chemical_mass": 56979.0, "monoisotopic_mass": 56979.0 }, "refseq": { "ac": "NP_001277563", "name": "UTP--glucose-1-phosphate uridylyltransferase isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277563" }, "gene_names": [ { "name": "Ugp2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q91ZJ5", "id": "Q91ZJ5" }, { "name": "UDPGP; UGPase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277563", "id": "NP_001277563" }, { "name": "Ugp2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277563", "id": "NP_001277563" } ], "protein_names": [ { "name": "UTP--glucose-1-phosphate uridylyltransferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q91ZJ5" }, { "name": "2.7.7.9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91ZJ5" }, { "name": "UDP-glucose pyrophosphorylase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91ZJ5" }, { "name": "UDPGP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91ZJ5" }, { "name": "UGPase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91ZJ5" }, { "name": "UTP--glucose-1-phosphate uridylyltransferase isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277563", "id": "NP_001277563" }, { "name": "UTP--glucose-1-phosphate uridylyltransferase; uridindiphosphoglucosepyrophosphorylase 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277563", "id": "NP_001277563" } ], "function": [ { "annotation": "UTP--glucose-1-phosphate uridylyltransferase catalyzing the conversion of glucose-1-phosphate into UDP-glucose, a crucial precursor for the production of glycogen.", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5#function" }, { "database": "UniProtKB", "id": "Q16851", "url": "https://www.uniprot.org/uniprot/Q16851#function" } ] } ], "disease": [ { "disease_id": "DOID:0112218", "recommended_name": { "id": "DOID:0112218", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112218", "name": "developmental and epileptic encephalopathy 83", "description": "A developmental and epileptic encephalopathy characterized by onset in the first days or months of life of frequent, usually refractory, seizures and profoundly impaired development that has_material_basis_in homozygous or compound heterozygous mutation in the UGP2 gene on chromosome 2p15." }, "synonyms": [ { "id": "DOID:0112218", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112218", "name": "DEE83", "description": "" }, { "id": "DOID:0112218", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112218", "name": "early infantile epileptic encephalopathy 83", "description": "" }, { "id": "MONDO:0032895", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032895", "name": "developmental and epileptic encephalopathy, 83", "description": "" }, { "id": "MONDO:0032895", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032895", "name": "DEE83", "description": "" }, { "id": "MONDO:0032895", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032895", "name": "EIEE83", "description": "" }, { "id": "MONDO:0032895", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032895", "name": "EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 83", "description": "" }, { "id": "MONDO:0032895", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032895", "name": "developmental and epileptic encephalopathy 83", "description": "" }, { "id": "MONDO:0032895", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032895", "name": "epileptic encephalopathy, early infantile, 83", "description": "" }, { "id": "MONDO:0032895", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032895", "name": "Barakat-Perenthaler Syndrome", "description": "" }, { "id": "MIM:618744", "resource": "MIM", "url": "https://www.omim.org/entry/618744", "name": "Developmental and epileptic encephalopathy 83", "description": "Developmental and epileptic encephalopathy 83" } ], "evidence": [ { "id": "0112218", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0112218" } ] }, { "disease_id": "DOID:162", "recommended_name": { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "cancer", "description": "A disease of cellular proliferation that is malignant and primary, characterized by uncontrolled cellular proliferation, local cell invasion and metastasis." }, "synonyms": [ { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "malignant neoplasm", "description": "" }, { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "malignant tumor", "description": "" }, { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "primary cancer", "description": "" } ], "evidence": [ { "id": "162", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:162" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Ugp2", "url": "https://www.uniprot.org/uniprot/Q91ZJ5", "locus": { "chromosome": "11", "start_pos": 21271138, "end_pos": 21321201, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000001891", "url": "https://www.ensembl.org/id/ENSMUSG00000001891" } ] } } ], "crossref": [ { "id": "ENSMUSG00000001891", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000001891", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00897", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00897", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "216558", "url": "https://www.ncbi.nlm.nih.gov/gene/216558", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q91ZJ5", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q91ZJ5*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002618", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002618", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016267", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016267", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029044", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029044", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:216558", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:216558", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2183447", "url": "http://www.informatics.jax.org/marker/MGI:2183447", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q91ZJ5", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q91ZJ5", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "QHMVETK", "url": "https://omabrowser.org/oma/group/QHMVETK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "45684at2759", "url": "http://www.orthodb.org/?query=45684at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43511:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43511:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01704", "url": "http://pfam.xfam.org/family/PF01704", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q91ZJ5", "url": "http://purl.obolibrary.org/obo/PR_Q91ZJ5", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-173599", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-173599", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-3322077", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3322077", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001277563", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277563", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "19889", "url": "https://www.rhea-db.org/rhea/19889", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q91ZJ5-1", "url": "https://www.uniprot.org/uniprot/Q91ZJ5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q91ZJ5-2", "url": "https://www.uniprot.org/uniprot/Q91ZJ5-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSRFVQDLSKAMSQDGASQFQEVILQELELSVKKELEKILTTAASHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPIAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIEEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLGAVKRLQEQNAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH", "length": 508, "header": "sp|Q91ZJ5-1|UGPA_MOUSE Isoform 1 of UTP--glucose-1-phosphate uridylyltransferase OS=Mus musculus OX=10090 GN=Ugp2 PE=1 SV=3 CANONICAL=Q91ZJ5-1" }, "isoforms": [ { "isoform_ac": "Q91ZJ5-1", "url": "", "sequence": { "sequence": "MSRFVQDLSKAMSQDGASQFQEVILQELELSVKKELEKILTTAASHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPIAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIEEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLGAVKRLQEQNAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH", "length": 508, "header": "sp|Q91ZJ5-1|UGPA_MOUSE Isoform 1 of UTP--glucose-1-phosphate uridylyltransferase OS=Mus musculus OX=10090 GN=Ugp2 PE=1 SV=3 CANONICAL=Q91ZJ5-1" }, "locus": { "chromosome": "11", "start_pos": 21320205, "end_pos": 21272025, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000102875", "url": "https://www.ensembl.org/id/ENSMUST00000102875" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000099939", "url": "https://www.ensembl.org/id/ENSMUSP00000099939" } ] } }, { "isoform_ac": "Q91ZJ5-2", "url": "", "sequence": { "sequence": "MSQDGASQFQEVILQELELSVKKELEKILTTAASHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPIAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIEEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLGAVKRLQEQNAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH", "length": 497, "header": "sp|Q91ZJ5-2|UGPA_MOUSE Isoform 2 of UTP--glucose-1-phosphate uridylyltransferase OS=Mus musculus OX=10090 GN=Ugp2 PE=1 SV=3 CANONICAL=Q91ZJ5-1" }, "locus": { "chromosome": "11", "start_pos": 21304392, "end_pos": 21272025, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000060895", "url": "https://www.ensembl.org/id/ENSMUST00000060895" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000056324", "url": "https://www.ensembl.org/id/ENSMUSP00000056324" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q91ZJ5", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q91ZJ5" }, { "id": "36288343", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36288343" } ] } ], "phosphorylation": [ { "start_pos": 13, "end_pos": 13, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ], "site_lbl": "Ser13" }, { "start_pos": 426, "end_pos": 426, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ], "site_lbl": "Thr426" }, { "start_pos": 434, "end_pos": 434, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ], "site_lbl": "Ser434" }, { "start_pos": 448, "end_pos": 448, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q91ZJ5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q91ZJ5" } ], "site_lbl": "Ser448" }, { "start_pos": 461, "end_pos": 461, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ], "site_lbl": "Ser461" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Comparative transcription map of the wobbler critical region on mouse chromosome 11 and the homologous region on human chromosome 2p13-14.", "journal": "BMC Genet.", "date": "2002", "authors": "Platzer M., Fuchs S., Thiel C., Resch K., Jockusch H., Schmitt-John T., Ulbrich M.", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ], "reference": [ { "type": "PubMed", "id": "12174196", "url": "https://glygen.org/publication/PubMed/12174196" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" }, { "database": "iPTMnet", "id": "Q91ZJ5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q91ZJ5" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "First comprehensive identification of cardiac proteins with putative increased O-GlcNAc levels during pressure overload hypertrophy.", "journal": "PloS one", "date": "2022", "authors": "Zhu Wei Zhong, Palazzo Teresa, Zhou Mowei, Ledee Dolena, Olson Heather M, Pa\u0161a-Toli\u0107 Ljiljana, Olson Aaron K", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q91ZJ5", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q91ZJ5" } ], "reference": [ { "type": "PubMed", "id": "36288343", "url": "https://glygen.org/publication/PubMed/36288343" } ] } ], "pathway": [ { "id": "mmu:216558", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:216558", "resource": "KEGG Pathway" }, { "id": "R-MMU-173599", "name": "Formation of the active cofactor, UDP-glucuronate", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-173599", "resource": "Reactome", "description": "Formation of the active cofactor, UDP-glucuronate" }, { "id": "R-MMU-3322077", "name": "Glycogen synthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3322077", "resource": "Reactome", "description": "Glycogen synthesis" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2K542-1", "protein_name": "UTP--glucose-1-phosphate uridylyltransferase", "gene_name": "Ugp2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSQMVFNLSKAMSQDGASQFQEVILQELELSVKKELEKILTTATSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPIAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIEEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH", "length": 508 }, "evidence": [ { "id": "45234796", "url": "http://www.informatics.jax.org/homology/45234796", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P32861-1", "protein_name": "UTP--glucose-1-phosphate uridylyltransferase", "gene_name": "UGP1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MSTKKHTKTHSTYAFESNTNSVAASQMRNALNKLADSSKLDDAARAKFENELDSFFTLFRRYLVEKSSRTTLEWDKIKSPNPDEVVKYEIISQQPENVSNLSKLAVLKLNGGLGTSMGCVGPKSVIEVREGNTFLDLSVRQIEYLNRQYDSDVPLLLMNSFNTDKDTEHLIKKYSANRIRIRSFNQSRFPRVYKDSLLPVPTEYDSPLDAWYPPGHGDLFESLHVSGELDALIAQGREILFVSNGDNLGATVDLKILNHMIETGAEYIMELTDKTRADVKGGTLISYDGQVRLLEVAQVPKEHIDEFKNIRKFTNFNTNNLWINLKAVKRLIESSNLEMEIIPNQKTITRDGHEINVLQLETACGAAIRHFDGAHGVVVPRSRFLPVKTCSDLLLVKSDLFRLEHGSLKLDPSRFGPNPLIKLGSHFKKVSGFNARIPHIPKIVELDHLTITGNVFLGKDVTLRGTVIIVCSDGHKIDIPNGSILENVVVTGNLQILEH", "length": 499 }, "evidence": [ { "id": "Q91ZJ5", "url": "https://omabrowser.org/oma/group/Q91ZJ5/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q16851-1", "protein_name": "UTP--glucose-1-phosphate uridylyltransferase", "gene_name": "UGP2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH", "length": 508 }, "evidence": [ { "id": "45234796", "url": "http://www.informatics.jax.org/homology/45234796", "database": "MGI" }, { "id": "Q91ZJ5", "url": "https://omabrowser.org/oma/group/Q91ZJ5/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ], "pmid": "" }, { "name": "UTP:glucose-1-phosphate uridylyltransferase activity", "id": "GO:0003983", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003983", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ], "pmid": "" }, { "name": "pyrimidine ribonucleotide binding", "id": "GO:0032557", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032557", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ], "pmid": "" }, { "name": "glucose binding", "id": "GO:0005536", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005536", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ], "pmid": "" }, { "name": "UTP-monosaccharide-1-phosphate uridylyltransferase activity", "id": "GO:0051748", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051748", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "glycogen metabolic process", "id": "GO:0005977", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005977", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ], "pmid": "" }, { "name": "brain development", "id": "GO:0007420", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007420", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ], "pmid": "" }, { "name": "glycogen biosynthetic process", "id": "GO:0005978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005978", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ], "pmid": "" }, { "name": "glucose 1-phosphate metabolic process", "id": "GO:0019255", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019255", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ], "pmid": "" }, { "name": "UDP-glucose metabolic process", "id": "GO:0006011", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006011", "evidence": [ { "database": "UniProtKB", "id": "Q91ZJ5", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 100, "end_pos": 102, "annotation": "n_glycosylation_sequon" }, { "start_pos": 150, "end_pos": 152, "annotation": "n_glycosylation_sequon" }, { "start_pos": 189, "end_pos": 191, "annotation": "n_glycosylation_sequon" }, { "start_pos": 284, "end_pos": 286, "annotation": "n_glycosylation_sequon" }, { "start_pos": 469, "end_pos": 471, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "19889", "name": "", "equation": "alpha-D-glucose 1-phosphate + H(+) + UTP = diphosphate + UDP-alpha-D-glucose", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2K542-1", "Q16851-1", "Q91ZJ5-1", "P32861-1", "P38709-1", "P08800-1", "Q54YZ0-1", "Q9VSW1-1" ], "evidence": [ { "id": "19889", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/19889" } ] }, { "id": "R-MMU-70286", "name": "UTP + D-glucose 1-phosphate <=> pyrophosphate + UDP-glucose", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q91ZJ5-1" ], "evidence": [ { "id": "R-MMU-70286", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-70286" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2K542", "gene_name": "Ugp2", "activity": [ { "ec_number": "2.7.7.9", "activity": "alpha-D-glucose 1-phosphate + H(+) + UTP = diphosphate + UDP-alpha-D-glucose.", "evidence": [ { "id": "A0A0G2K542", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K542" } ] }, { "ec_number": "2.7.7.9", "activity": "", "evidence": [ { "id": "A0A0G2K542", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K542" } ] } ] }, { "uniprot_ac": "P08800", "gene_name": "uppA", "activity": [ { "ec_number": "2.7.7.9", "activity": "alpha-D-glucose 1-phosphate + H(+) + UTP = diphosphate + UDP-alpha-D-glucose.", "evidence": [ { "id": "P08800", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08800" } ] }, { "ec_number": "2.7.7.9", "activity": "", "evidence": [ { "id": "P08800", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08800" } ] } ] }, { "uniprot_ac": "P32861", "gene_name": "UGP1", "activity": [ { "ec_number": "2.7.7.9", "activity": "alpha-D-glucose 1-phosphate + H(+) + UTP = diphosphate + UDP-alpha-D-glucose.", "evidence": [ { "id": "P32861", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32861" } ] }, { "ec_number": "2.7.7.9", "activity": "", "evidence": [ { "id": "P32861", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32861" } ] } ] }, { "uniprot_ac": "P38709", "gene_name": "", "activity": [ { "ec_number": "2.7.7.9", "activity": "alpha-D-glucose 1-phosphate + H(+) + UTP = diphosphate + UDP-alpha-D-glucose.", "evidence": [ { "id": "P38709", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38709" } ] }, { "ec_number": "2.7.7.9", "activity": "", "evidence": [ { "id": "P38709", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38709" } ] } ] }, { "uniprot_ac": "Q16851", "gene_name": "UGP2", "activity": [ { "ec_number": "2.7.7.9", "activity": "alpha-D-glucose 1-phosphate + H(+) + UTP = diphosphate + UDP-alpha-D-glucose.", "evidence": [ { "id": "Q16851", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16851" } ] }, { "ec_number": "2.7.7.9", "activity": "", "evidence": [ { "id": "Q16851", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16851" } ] } ] }, { "uniprot_ac": "Q54YZ0", "gene_name": "ugpB", "activity": [ { "ec_number": "2.7.7.9", "activity": "alpha-D-glucose 1-phosphate + H(+) + UTP = diphosphate + UDP-alpha-D-glucose.", "evidence": [ { "id": "Q54YZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54YZ0" } ] }, { "ec_number": "2.7.7.9", "activity": "", "evidence": [ { "id": "Q54YZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54YZ0" } ] } ] }, { "uniprot_ac": "Q91ZJ5", "gene_name": "Ugp2", "activity": [ { "ec_number": "2.7.7.9", "activity": "alpha-D-glucose 1-phosphate + H(+) + UTP = diphosphate + UDP-alpha-D-glucose.", "evidence": [ { "id": "Q91ZJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ] }, { "ec_number": "2.7.7.9", "activity": "", "evidence": [ { "id": "Q91ZJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZJ5" } ] } ] }, { "uniprot_ac": "Q9VSW1", "gene_name": "UGP", "activity": [ { "ec_number": "2.7.7.9", "activity": "alpha-D-glucose 1-phosphate + H(+) + UTP = diphosphate + UDP-alpha-D-glucose.", "evidence": [ { "id": "Q9VSW1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VSW1" } ] }, { "ec_number": "2.7.7.9", "activity": "", "evidence": [ { "id": "Q9VSW1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VSW1" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }