{ "uniprot_canonical_ac": "Q91Z31-1", "uniprot_ac": "Q91Z31", "uniprot_id": "PTBP2_MOUSE", "mass": { "chemical_mass": 57489.0, "monoisotopic_mass": 57489.0 }, "refseq": { "ac": "NP_001297640", "name": "polypyrimidine tract-binding protein 2 isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297640" }, "gene_names": [ { "name": "Ptbp2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q91Z31", "id": "Q91Z31" }, { "name": "Brptb", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q91Z31", "id": "Q91Z31" }, { "name": "Nptb", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q91Z31", "id": "Q91Z31" }, { "name": "Ptbp2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297640", "id": "NP_001297640" }, { "name": "brPTB; nPTB; Ptb2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297640", "id": "NP_001297640" } ], "protein_names": [ { "name": "Polypyrimidine tract-binding protein 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q91Z31" }, { "name": "Brain-enriched PTB", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91Z31" }, { "name": "Brain-enriched polypyrimidine tract-binding protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91Z31" }, { "name": "Neural polypyrimidine tract-binding protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91Z31" }, { "name": "RRM-type RNA-binding protein brPTB", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91Z31" }, { "name": "brain-enriched PTB; RRM-type RNA-binding protein brPTB; neural polypyrimidine tract-binding protein; brain-enriched polypyrimidine tract-binding protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297640", "id": "NP_001297640" }, { "name": "polypyrimidine tract-binding protein 2 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297640", "id": "NP_001297640" } ], "function": [ { "annotation": "Axonogenesis-associated splicing changes are governed by PTBP2.", "evidence": [ { "database": "RefSeq", "id": "NP_001297640", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297640" }, { "database": "PubMed", "id": "30733148", "url": "https://glygen.org/publication/PubMed/30733148" } ] }, { "annotation": "HnRNPH1 recruits PTBP2 and SRSF3 to modulate alternative splicing in germ cells. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001297640", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297640" }, { "database": "PubMed", "id": "35739118", "url": "https://glygen.org/publication/PubMed/35739118" } ] }, { "annotation": "PTBP2 was identified as a brain-expressed protein that interacts with the paraneoplastic target antigen Nova1 by yeast 2-hybrid, in vivo co-IP and co-localization in neurons. Functionally, the proteins antagonize each other in splicing assays.", "evidence": [ { "database": "RefSeq", "id": "NP_001297640", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297640" }, { "database": "PubMed", "id": "10829067", "url": "https://glygen.org/publication/PubMed/10829067" } ] }, { "annotation": "RNA-binding protein which binds to intronic polypyrimidine tracts and mediates negative regulation of exons splicing (PubMed:10829067, PubMed:30638744). May antagonize in a tissue-specific manner the ability of NOVA1 to activate exon selection (PubMed:10829067). In addition to its function in pre-mRNA splicing, also plays a role in the regulation of translation (PubMed:11726525).", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31#function" }, { "database": "PubMed", "id": "10829067", "url": "https://glygen.org/publication/PubMed/10829067" }, { "database": "PubMed", "id": "11726525", "url": "https://glygen.org/publication/PubMed/11726525" }, { "database": "PubMed", "id": "30638744", "url": "https://glygen.org/publication/PubMed/30638744" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Ptbp2", "url": "https://www.uniprot.org/uniprot/Q91Z31", "locus": { "chromosome": "3", "start_pos": 119512391, "end_pos": 119578115, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000028134", "url": "https://www.ensembl.org/id/ENSMUSG00000028134" } ] } } ], "crossref": [ { "id": "ENSMUSG00000028134", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000028134", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd12696", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12696", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd12702", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12702", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd12778", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12778", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd12783", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12783", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "56195", "url": "https://www.ncbi.nlm.nih.gov/gene/56195", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q91Z31", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q91Z31*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006536", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006536", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012677", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012677", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR021790", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021790", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034799", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034799", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034800", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034800", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035002", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035002", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:56195", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:56195", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1860489", "url": "http://www.informatics.jax.org/marker/MGI:1860489", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q91Z31", "url": "https://oglcnac.org/atlas/detail/Q91Z31", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "Q91Z31", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q91Z31", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "IHHVLYP", "url": "https://omabrowser.org/oma/group/IHHVLYP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4825346at2759", "url": "http://www.orthodb.org/?query=4825346at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15592", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15592", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15592:SF16", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15592:SF16", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00076", "url": "http://pfam.xfam.org/family/PF00076", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF11835", "url": "http://pfam.xfam.org/family/PF11835", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13893", "url": "http://pfam.xfam.org/family/PF13893", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q91Z31", "url": "http://purl.obolibrary.org/obo/PR_Q91Z31", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001297640", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297640", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0G2JE77", "url": "https://www.uniprot.org/uniprot/A0A0G2JE77", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JE77-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JE77-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JEB9", "url": "https://www.uniprot.org/uniprot/A0A0G2JEB9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JEB9-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JEB9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JFV8", "url": "https://www.uniprot.org/uniprot/A0A0G2JFV8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JFV8-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JFV8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JGW0", "url": "https://www.uniprot.org/uniprot/A0A0G2JGW0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JGW0-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JGW0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3V328", "url": "https://www.uniprot.org/uniprot/Q3V328", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3V328-1", "url": "https://www.uniprot.org/uniprot/Q3V328-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q91Z31-1", "url": "https://www.uniprot.org/uniprot/Q91Z31-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q91Z31-2", "url": "https://www.uniprot.org/uniprot/Q91Z31-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSGMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMYYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPSGDGQPALDPAIAAAFAKETSLLAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAGGNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI", "length": 531, "header": "sp|Q91Z31-1|PTBP2_MOUSE Isoform 1 of Polypyrimidine tract-binding protein 2 OS=Mus musculus OX=10090 GN=Ptbp2 PE=1 SV=2 CANONICAL=Q91Z31-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JE77-1", "url": "", "sequence": { "sequence": "MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSGMVVTGHKRMEHTSFS", "length": 49, "header": "tr|A0A0G2JE77-1|PTBP2_MOUSE Computationally mapped isoform of Polypyrimidine tract-binding protein 2 OS=Mus musculus OX=10090 GN=Ptbp2 PE=1 SV=1 CANONICAL=Q91Z31-1" }, "locus": { "chromosome": "3", "start_pos": 119576858, "end_pos": 119554349, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000198403.2", "url": "https://www.ensembl.org/id/ENSMUST00000198403.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000142664.2", "url": "https://www.ensembl.org/id/ENSMUSP00000142664.2" } ] } }, { "isoform_ac": "A0A0G2JEB9-1", "url": "", "sequence": { "sequence": "AGRVGMPGVSAGGNTVLLVSNLNEEVFMEMCSA", "length": 33, "header": "tr|A0A0G2JEB9-1|PTBP2_MOUSE Computationally mapped isoform of Polypyrimidine tract-binding protein 2 OS=Mus musculus OX=10090 GN=Ptbp2 PE=1 SV=1 CANONICAL=Q91Z31-1" }, "locus": { "chromosome": "3", "start_pos": 119519789, "end_pos": 119517812, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000197387.5", "url": "https://www.ensembl.org/id/ENSMUST00000197387.5" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000142711.2", "url": "https://www.ensembl.org/id/ENSMUSP00000142711.2" } ] } }, { "isoform_ac": "A0A0G2JFV8-1", "url": "", "sequence": { "sequence": "ALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPSGDGQPALDPAIAAAFAKETSLLGLPVAAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAGGNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGN", "length": 155, "header": "tr|A0A0G2JFV8-1|PTBP2_MOUSE Computationally mapped isoform of Polypyrimidine tract-binding protein 2 OS=Mus musculus OX=10090 GN=Ptbp2 PE=1 SV=1 CANONICAL=Q91Z31-1" }, "locus": { "chromosome": "3", "start_pos": 119534159, "end_pos": 119517756, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000195902.2", "url": "https://www.ensembl.org/id/ENSMUST00000195902.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000143325.2", "url": "https://www.ensembl.org/id/ENSMUSP00000143325.2" } ] } }, { "isoform_ac": "A0A0G2JGW0-1", "url": "", "sequence": { "sequence": "MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSGMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMYYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPSGDGQPALDPAIAAAFAKETSLLAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAGGNTVLLVSNLNEEVFMEMCSA", "length": 356, "header": "tr|A0A0G2JGW0-1|PTBP2_MOUSE Computationally mapped isoform of Polypyrimidine tract-binding protein 2 OS=Mus musculus OX=10090 GN=Ptbp2 PE=1 SV=1 CANONICAL=Q91Z31-1" }, "locus": { "chromosome": "3", "start_pos": 119576858, "end_pos": 119517812, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000197833.5", "url": "https://www.ensembl.org/id/ENSMUST00000197833.5" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000143719.2", "url": "https://www.ensembl.org/id/ENSMUSP00000143719.2" } ] } }, { "isoform_ac": "Q3V328-1", "url": "", "sequence": { "sequence": "MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSGMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMYYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLVSRGS", "length": 241, "header": "tr|Q3V328-1|PTBP2_MOUSE Computationally mapped isoform of Polypyrimidine tract-binding protein 2 OS=Mus musculus OX=10090 GN=Ptbp2 PE=1 SV=1 CANONICAL=Q91Z31-1" }, "locus": { "chromosome": "3", "start_pos": 119576858, "end_pos": 119541226, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000197464.5", "url": "https://www.ensembl.org/id/ENSMUST00000197464.5" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000143281.2", "url": "https://www.ensembl.org/id/ENSMUSP00000143281.2" } ] } }, { "isoform_ac": "Q91Z31-1", "url": "", "sequence": { "sequence": "MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSGMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMYYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPSGDGQPALDPAIAAAFAKETSLLAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAGGNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI", "length": 531, "header": "sp|Q91Z31-1|PTBP2_MOUSE Isoform 1 of Polypyrimidine tract-binding protein 2 OS=Mus musculus OX=10090 GN=Ptbp2 PE=1 SV=2 CANONICAL=Q91Z31-1" }, "locus": { "chromosome": "3", "start_pos": 119576858, "end_pos": 119513980, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000200097", "url": "https://www.ensembl.org/id/ENSMUST00000200097" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000143510", "url": "https://www.ensembl.org/id/ENSMUSP00000143510" } ] } }, { "isoform_ac": "Q91Z31-2", "url": "", "sequence": { "sequence": "MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSGMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMYYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPSGDGQPALDPAIAAAFAKETSLLAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAGGNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQRDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI", "length": 532, "header": "sp|Q91Z31-2|PTBP2_MOUSE Isoform 2 of Polypyrimidine tract-binding protein 2 OS=Mus musculus OX=10090 GN=Ptbp2 PE=1 SV=2 CANONICAL=Q91Z31-1" }, "locus": { "chromosome": "3", "start_pos": 119576858, "end_pos": 119513980, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000029780", "url": "https://www.ensembl.org/id/ENSMUST00000029780" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000029780", "url": "https://www.ensembl.org/id/ENSMUSP00000029780" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 154, "start_aa": "Thr", "end_pos": 154, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr154", "evidence": [ { "id": "Q91Z31", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q91Z31" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 6, "start_aa": "Thr", "end_pos": 6, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr6", "evidence": [ { "id": "Q91Z31", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q91Z31" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q91Z31", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q91Z31" }, { "id": "22645316", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22645316" } ] } ], "phosphorylation": [ { "start_pos": 26, "end_pos": 26, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q91Z31", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q91Z31" } ], "site_lbl": "Ser26" }, { "start_pos": 27, "end_pos": 27, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "phospho.ELM", "id": "Q91Z31", "url": "http://phospho.elm.eu.org/byAccession/Q91Z31.html" }, { "database": "iPTMnet", "id": "Q91Z31", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q91Z31" }, { "database": "PubMed", "id": "15345747", "url": "https://glygen.org/publication/PubMed/15345747" } ], "site_lbl": "Ser27" }, { "start_pos": 308, "end_pos": 308, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" }, { "database": "PubMed", "id": "15345747", "url": "https://glygen.org/publication/PubMed/15345747" }, { "database": "phospho.ELM", "id": "Q91Z31", "url": "http://phospho.elm.eu.org/byAccession/Q91Z31.html" }, { "database": "iPTMnet", "id": "Q91Z31", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q91Z31" } ], "site_lbl": "Ser308" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "A brain-enriched polypyrimidine tract-binding protein antagonizes the ability of Nova to regulate neuron-specific alternative splicing.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2000", "authors": "Polydorides AD, Okano HJ, Yang YY, Stefani G, Darnell RB", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" }, { "database": "RefSeq", "id": "NP_001297640", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297640" } ], "reference": [ { "type": "PubMed", "id": "10829067", "url": "https://glygen.org/publication/PubMed/10829067" } ] }, { "title": "Comparative expression analysis of the genes encoding polypyrimidine tract binding protein (PTB) and its neural homologue (brPTB) in prenatal and postnatal mouse brain.", "journal": "Mech. Dev.", "date": "2001", "authors": "Lillevali K, Kulla A, Ord T", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" } ], "reference": [ { "type": "PubMed", "id": "11231079", "url": "https://glygen.org/publication/PubMed/11231079" } ] }, { "title": "Cell-specific proteins regulate viral RNA translation and virus-induced disease.", "journal": "EMBO J.", "date": "2001", "authors": "Roos R.P., Agol V.I., Pilipenko E.V., Guest S.T., Viktorova E.G.", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" } ], "reference": [ { "type": "PubMed", "id": "11726525", "url": "https://glygen.org/publication/PubMed/11726525" } ] }, { "title": "Alternative splicing of brain-specific PTB defines a tissue-specific isoform pattern that predicts distinct functional roles.", "journal": "Genomics", "date": "2002", "authors": "Zajac-Kaye M., Bliskovski V., Rahman L., Reinhold W.", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" } ], "reference": [ { "type": "PubMed", "id": "12213192", "url": "https://glygen.org/publication/PubMed/12213192" } ] }, { "title": "Evolutionary conservation of a 2-kb intronic sequence flanking a tissue-specific alternative exon in the PTBP2 gene.", "journal": "Genomics", "date": "2004", "authors": "Rahman L, Bliskovski V, Kaye FJ, Zajac-Kaye M", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" } ], "reference": [ { "type": "PubMed", "id": "14667811", "url": "https://glygen.org/publication/PubMed/14667811" } ] }, { "title": "Phosphoproteomic analysis of the developing mouse brain.", "journal": "Molecular & cellular proteomics : MCP", "date": "2004", "authors": "Ballif BA, Villen J, Beausoleil SA, Schwartz D, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" }, { "database": "UniProtKB", "id": "A0A0G2JGW0", "url": "https://www.uniprot.org/uniprot/A0A0G2JGW0" }, { "database": "UniProtKB", "id": "Q3V328", "url": "https://www.uniprot.org/uniprot/Q3V328" }, { "database": "iPTMnet", "id": "Q91Z31", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q91Z31" } ], "reference": [ { "type": "PubMed", "id": "15345747", "url": "https://glygen.org/publication/PubMed/15345747" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" }, { "database": "iPTMnet", "id": "Q91Z31", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q91Z31" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "Global identification and characterization of both O-GlcNAcylation and phosphorylation at the murine synapse.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Trinidad JC, Barkan DT, Gulledge BF, Thalhammer A, Sali A, Schoepfer R, Burlingame AL", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q91Z31", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q91Z31" } ], "reference": [ { "type": "PubMed", "id": "22645316", "url": "https://glygen.org/publication/PubMed/22645316" } ] }, { "title": "Differential NOVA2-Mediated Splicing in Excitatory and Inhibitory Neurons Regulates Cortical Development and Cerebellar Function.", "journal": "Neuron", "date": "2019", "authors": "Saito Y, Yuan Y, Zucker-Scharff I, Fak JJ, Jereb S, Tajima Y, Licatalosi DD, Darnell RB", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" } ], "reference": [ { "type": "PubMed", "id": "30638744", "url": "https://glygen.org/publication/PubMed/30638744" } ] }, { "title": "Axonogenesis Is Coordinated by Neuron-Specific Alternative Splicing Programming and Splicing Regulator PTBP2.", "journal": "Neuron", "date": "2019", "authors": "Zhang M, Ergin V, Lin L, Stork C, Chen L, Zheng S", "evidence": [ { "database": "RefSeq", "id": "NP_001297640", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297640" } ], "reference": [ { "type": "PubMed", "id": "30733148", "url": "https://glygen.org/publication/PubMed/30733148" } ] }, { "title": "Age-related loss of neural stem cell O-GlcNAc promotes a glial fate switch through STAT3 activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "White CW 3rd, Fan X, Maynard JC, Wheatley EG, Bieri G, Couthouis J, Burlingame AL, Villeda SA", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "Q91Z31", "url": "https://oglcnac.org/atlas/detail/Q91Z31" } ], "reference": [ { "type": "PubMed", "id": "32848054", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "title": "hnRNPH1 recruits PTBP2 and SRSF3 to modulate alternative splicing in germ cells.", "journal": "Nature communications", "date": "2022", "authors": "Feng S, Li J, Wen H, Liu K, Gui Y, Wen Y, Wang X, Yuan S", "evidence": [ { "database": "RefSeq", "id": "NP_001297640", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297640" } ], "reference": [ { "type": "PubMed", "id": "35739118", "url": "https://glygen.org/publication/PubMed/35739118" } ] } ], "pathway": [ { "id": "mmu:56195", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:56195", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q66H20-1", "protein_name": "Polypyrimidine tract-binding protein 2", "gene_name": "Ptbp2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSGMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMYYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPSGDGQPALDPAIAAAFAKETSLLAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAGGNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI", "length": 531 }, "evidence": [ { "id": "45234120", "url": "http://www.informatics.jax.org/homology/45234120", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9UKA9-1", "protein_name": "Polypyrimidine tract-binding protein 2", "gene_name": "PTBP2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMYYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPSGDGQPALDPAIAAAFAKETSLLAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAGGNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI", "length": 531 }, "evidence": [ { "id": "45234120", "url": "http://www.informatics.jax.org/homology/45234120", "database": "MGI" }, { "id": "Q91Z31", "url": "https://omabrowser.org/oma/group/Q91Z31/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" } ], "pmid": "" }, { "name": "mRNA binding", "id": "GO:0003729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003729", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" } ], "pmid": "" }, { "name": "growth cone", "id": "GO:0030426", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030426", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" } ], "pmid": "" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" } ], "pmid": "" }, { "name": "spliceosomal complex", "id": "GO:0005681", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005681", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "mRNA processing", "id": "GO:0006397", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006397", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" } ], "pmid": "" }, { "name": "regulation of RNA splicing", "id": "GO:0043484", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043484", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" } ], "pmid": "" }, { "name": "mRNA splice site recognition", "id": "GO:0006376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006376", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" } ], "pmid": "" }, { "name": "negative regulation of RNA splicing", "id": "GO:0033119", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033119", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" } ], "pmid": "" }, { "name": "regulation of neural precursor cell proliferation", "id": "GO:2000177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000177", "evidence": [ { "database": "UniProtKB", "id": "Q91Z31", "url": "https://www.uniprot.org/uniprot/Q91Z31" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 31, "end_pos": 33, "annotation": "n_glycosylation_sequon" }, { "start_pos": 386, "end_pos": 388, "annotation": "n_glycosylation_sequon" }, { "start_pos": 42, "end_pos": 44, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }