{ "uniprot_canonical_ac": "Q91XU8-1", "uniprot_ac": "Q91XU8", "uniprot_id": "CDS2_RAT", "mass": { "chemical_mass": 51323.0, "monoisotopic_mass": 51323.0 }, "refseq": { "ac": "NP_446095", "name": "phosphatidate cytidylyltransferase 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446095" }, "gene_names": [ { "name": "Cds2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q91XU8", "id": "Q91XU8" }, { "name": "Cds2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446095", "id": "NP_446095" } ], "protein_names": [ { "name": "Phosphatidate cytidylyltransferase 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q91XU8" }, { "name": "2.7.7.41", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91XU8" }, { "name": "CDP-DAG synthase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91XU8" }, { "name": "CDP-DG synthase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91XU8" }, { "name": "CDP-diacylglycerol synthase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91XU8" }, { "name": "CDP-diglyceride pyrophosphorylase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91XU8" }, { "name": "CDP-diglyceride synthase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91XU8" }, { "name": "CDS 2; CDP-DAG synthase 2; CDP-DG synthetase 2; CDP-diglyceride synthetase 2; CDP-diglyceride pyrophosphorylase 2; CTP:phosphatidate cytidylyltransferase 2; CDP-DG synthase 2; CDP-diglyceride synthase 2; CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446095", "id": "NP_446095" }, { "name": "CDS 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91XU8" }, { "name": "CTP:phosphatidate cytidylyltransferase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91XU8" }, { "name": "phosphatidate cytidylyltransferase 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446095", "id": "NP_446095" } ], "function": [ { "annotation": "Catalyzes the conversion of phosphatidic acid (PA) to CDP-diacylglycerol (CDP-DAG), an essential intermediate in the synthesis of phosphatidylglycerol, cardiolipin and phosphatidylinositol.", "evidence": [ { "database": "UniProtKB", "id": "G3V8W2", "url": "https://www.uniprot.org/uniprot/G3V8W2#function" }, { "database": "UniProtKB", "id": "PIRNR018269", "url": "https://www.uniprot.org/uniprot/PIRNR018269#function" }, { "database": "UniProtKB", "id": "Q91XU8", "url": "https://www.uniprot.org/uniprot/Q91XU8#function" }, { "database": "UniProtKB", "id": "O95674", "url": "https://www.uniprot.org/uniprot/O95674#function" }, { "database": "PubMed", "id": "29253589", "url": "https://glygen.org/publication/PubMed/29253589" }, { "database": "UniProtKB", "id": "A0A8I6AMA9", "url": "https://www.uniprot.org/uniprot/A0A8I6AMA9#function" } ] } ], "disease": [ { "disease_id": "DOID:162", "recommended_name": { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "cancer", "description": "A disease of cellular proliferation that is malignant and primary, characterized by uncontrolled cellular proliferation, local cell invasion and metastasis." }, "synonyms": [ { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "malignant neoplasm", "description": "" }, { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "malignant tumor", "description": "" }, { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "primary cancer", "description": "" } ], "evidence": [ { "id": "162", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:162" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q91XU8", "url": "https://www.uniprot.org/uniprot/Q91XU8" } ], "common_name": "Rat" } ], "gene": [ { "name": "Cds2", "url": "https://www.uniprot.org/uniprot/Q91XU8", "locus": { "chromosome": "3", "start_pos": 119553541, "end_pos": 119515000, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000021265", "url": "https://www.ensembl.org/id/ENSRNOG00000021265" } ] } } ], "crossref": [ { "id": "ENSRNOG00000021265", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000021265", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "114101", "url": "https://www.ncbi.nlm.nih.gov/gene/114101", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000374", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000374", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016720", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016720", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:114101", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:114101", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "MPIQWHA", "url": "https://omabrowser.org/oma/group/MPIQWHA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5481516at2759", "url": "http://www.orthodb.org/?query=5481516at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13773", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13773", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13773:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13773:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01148", "url": "http://pfam.xfam.org/family/PF01148", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q91XU8", "url": "http://purl.obolibrary.org/obo/PR_Q91XU8", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-1483148", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1483148", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_446095", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446095", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "621186", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=621186", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "16229", "url": "https://www.rhea-db.org/rhea/16229", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "45648", "url": "https://www.rhea-db.org/rhea/45648", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "45652", "url": "https://www.rhea-db.org/rhea/45652", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "45656", "url": "https://www.rhea-db.org/rhea/45656", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "45660", "url": "https://www.rhea-db.org/rhea/45660", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "45664", "url": "https://www.rhea-db.org/rhea/45664", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "45668", "url": "https://www.rhea-db.org/rhea/45668", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "45672", "url": "https://www.rhea-db.org/rhea/45672", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "45676", "url": "https://www.rhea-db.org/rhea/45676", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A8I6AMA9", "url": "https://www.uniprot.org/uniprot/A0A8I6AMA9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AMA9-1", "url": "https://www.uniprot.org/uniprot/A0A8I6AMA9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V8W2", "url": "https://www.uniprot.org/uniprot/G3V8W2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V8W2-1", "url": "https://www.uniprot.org/uniprot/G3V8W2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q91XU8", "url": "https://www.uniprot.org/uniprot/Q91XU8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q91XU8-1", "url": "https://www.uniprot.org/uniprot/Q91XU8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTELRQRAVREDAPPEDKESESEAKLDGETASDSESRAETAPPPTSIDDTPEVLNRALSNLSSRWKNWWVRGILTMAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSLVGWKTMRMYPFQIHSALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLKSHLTDKGILMSALEEE", "length": 443, "header": "sp|Q91XU8-1|CDS2_RAT Isoform 1 of Phosphatidate cytidylyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Cds2 PE=1 SV=1 CANONICAL=Q91XU8-1" }, "isoforms": [ { "isoform_ac": "A0A8I6AMA9-1", "url": "", "sequence": { "sequence": "ESESEAKLDGETASDSESRAETAPPPTSIDDTPEVLNRALSNLSSRWKNWWVRGILTMAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSLVGWKTMRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLKSHLTDKGILMSALEEE", "length": 426, "header": "tr|A0A8I6AMA9-1|CDS2_RAT Computationally mapped isoform of Phosphatidate cytidylyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Cds2 PE=1 SV=1 CANONICAL=Q91XU8-1" }, "locus": { "chromosome": "3", "start_pos": 119553436, "end_pos": 119540476, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000093797.1", "url": "https://www.ensembl.org/id/ENSRNOT00000093797.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000095068.1", "url": "https://www.ensembl.org/id/ENSRNOP00000095068.1" } ] } }, { "isoform_ac": "G3V8W2-1", "url": "", "sequence": { "sequence": "MTELRQRAVREDAPPEDKESESEAKLDGETASDSESRAETAPPPTSIDDTPEVLNRALSNLSSRWKNWWVRGILTMAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSLVGWKTMRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLKSHLTDKGILMSALEEE", "length": 444, "header": "tr|G3V8W2-1|CDS2_RAT Computationally mapped isoform of Phosphatidate cytidylyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Cds2 PE=1 SV=1 CANONICAL=Q91XU8-1" }, "locus": { "chromosome": "3", "start_pos": 119553436, "end_pos": 119515079, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000028888.4", "url": "https://www.ensembl.org/id/ENSRNOT00000028888.4" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000028888.1", "url": "https://www.ensembl.org/id/ENSRNOP00000028888.1" } ] } }, { "isoform_ac": "Q91XU8-1", "url": "", "sequence": { "sequence": "MTELRQRAVREDAPPEDKESESEAKLDGETASDSESRAETAPPPTSIDDTPEVLNRALSNLSSRWKNWWVRGILTMAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSLVGWKTMRMYPFQIHSALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLKSHLTDKGILMSALEEE", "length": 443, "header": "sp|Q91XU8-1|CDS2_RAT Isoform 1 of Phosphatidate cytidylyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Cds2 PE=1 SV=1 CANONICAL=Q91XU8-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q91XU8", "url": "https://www.uniprot.org/uniprot/Q91XU8" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "iPTMnet", "id": "Q91XU8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q91XU8" } ], "site_lbl": "Ser20" }, { "start_pos": 30, "end_pos": 30, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q91XU8", "url": "https://www.uniprot.org/uniprot/Q91XU8" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "iPTMnet", "id": "Q91XU8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q91XU8" } ], "site_lbl": "Thr30" }, { "start_pos": 32, "end_pos": 32, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q91XU8", "url": "https://www.uniprot.org/uniprot/Q91XU8" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "iPTMnet", "id": "Q91XU8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q91XU8" } ], "site_lbl": "Ser32" }, { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q91XU8", "url": "https://www.uniprot.org/uniprot/Q91XU8" } ], "site_lbl": "Ser34" }, { "start_pos": 36, "end_pos": 36, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q91XU8", "url": "https://www.uniprot.org/uniprot/Q91XU8" } ], "site_lbl": "Ser36" }, { "start_pos": 50, "end_pos": 50, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q91XU8", "url": "https://www.uniprot.org/uniprot/Q91XU8" } ], "site_lbl": "Thr50" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nature communications", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "Q91XU8", "url": "https://www.uniprot.org/uniprot/Q91XU8" }, { "database": "UniProtKB", "id": "G3V8W2", "url": "https://www.uniprot.org/uniprot/G3V8W2" }, { "database": "iPTMnet", "id": "Q91XU8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q91XU8" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] }, { "title": "Mitochondrial CDP-diacylglycerol synthase activity is due to the peripheral protein, TAMM41 and not due to the integral membrane protein, CDP-diacylglycerol synthase 1.", "journal": "Biochim. Biophys. Acta", "date": "2018", "authors": "Blunsom NJ, Gomez-Espinosa E, Ashlin TG, Cockcroft S", "evidence": [ { "database": "UniProtKB", "id": "Q91XU8", "url": "https://www.uniprot.org/uniprot/Q91XU8" } ], "reference": [ { "type": "PubMed", "id": "29253589", "url": "https://glygen.org/publication/PubMed/29253589" } ] } ], "pathway": [ { "id": "rno:114101", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:114101", "resource": "KEGG Pathway" }, { "id": "R-RNO-1483148", "name": "Synthesis of PG", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1483148", "resource": "Reactome", "description": "Synthesis of PG" } ], "orthologs": [ { "uniprot_canonical_ac": "O95674-1", "protein_name": "Phosphatidate cytidylyltransferase 2", "gene_name": "CDS2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLIGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLRSHLIDKGMLTSTTEDE", "length": 445 }, "evidence": [ { "id": "45231951", "url": "http://www.informatics.jax.org/homology/45231951", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q99L43-1", "protein_name": "Phosphatidate cytidylyltransferase 2", "gene_name": "Cds2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTELRQRVVREDAPPEDKESESEAKLDGETASDSESRAETAPLPTSVDDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFALYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSAIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLKSHLTDKGILTSALEDE", "length": 444 }, "evidence": [ { "id": "45231951", "url": "http://www.informatics.jax.org/homology/45231951", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q91XU8", "url": "https://www.uniprot.org/uniprot/Q91XU8" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "Q91XU8", "url": "https://www.uniprot.org/uniprot/Q91XU8" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "Q91XU8", "url": "https://www.uniprot.org/uniprot/Q91XU8" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "phosphatidate cytidylyltransferase activity", "id": "GO:0004605", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004605", "evidence": [ { "database": "UniProtKB", "id": "Q91XU8", "url": "https://www.uniprot.org/uniprot/Q91XU8" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "CDP-diacylglycerol biosynthetic process", "id": "GO:0016024", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016024", "evidence": [ { "database": "UniProtKB", "id": "Q91XU8", "url": "https://www.uniprot.org/uniprot/Q91XU8" } ], "pmid": "" }, { "name": "lipid droplet formation", "id": "GO:0140042", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140042", "evidence": [ { "database": "UniProtKB", "id": "Q91XU8", "url": "https://www.uniprot.org/uniprot/Q91XU8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 294, "end_pos": 296, "annotation": "n_glycosylation_sequon" }, { "start_pos": 60, "end_pos": 62, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "16229", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phosphate + CTP + H(+) = a CDP-1,2-diacyl-sn-glycerol + diphosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q91XU8-1", "O35052-1", "D3ZKT0-1", "O95674-1", "Q92903-1", "Q96BW9-1", "P98191-1", "Q99L43-1", "Q3TUH1-1", "P53230-1", "P38221-1", "Q550P4-1", "Q55D90-1", "Q8INF2-1", "P56079-1" ], "evidence": [ { "id": "16229", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/16229" } ] }, { "id": "45648", "name": "", "equation": "1-octadecanoyl-2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-phosphate + CTP + H(+) = 1-octadecanoyl-2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-cytidine-5'-diphosphate + diphosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O35052-1", "Q91XU8-1", "O95674-1", "Q92903-1", "P98191-1", "Q99L43-1" ], "evidence": [ { "id": "45648", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/45648" } ] }, { "id": "45652", "name": "", "equation": "1-hexadecanoyl-2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-phosphate + CTP + H(+) = 1-hexadecanoyl-2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-cytidine-5'-diphosphate + diphosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O35052-1", "Q91XU8-1", "O95674-1", "Q92903-1", "P98191-1", "Q99L43-1" ], "evidence": [ { "id": "45652", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/45652" } ] }, { "id": "45656", "name": "", "equation": "1,2-di-(5Z,8Z,11Z,14Z)-eicosatetraenoyl-sn-glycero-3-phosphate + CTP + H(+) = 1,2-di-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-cytidine-5'-diphosphate + diphosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O35052-1", "Q91XU8-1", "O95674-1", "Q92903-1", "P98191-1", "Q99L43-1" ], "evidence": [ { "id": "45656", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/45656" } ] }, { "id": "45660", "name": "", "equation": "1-octadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphate + CTP + H(+) = 1-octadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-cytidine-5'-diphosphate + diphosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q91XU8-1", "O35052-1", "O95674-1", "Q92903-1", "P98191-1", "Q99L43-1" ], "evidence": [ { "id": "45660", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/45660" } ] }, { "id": "45664", "name": "", "equation": "1-octadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phosphate + CTP + H(+) = 1-octadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-cytidine-5'-diphosphate + diphosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O35052-1", "Q91XU8-1", "O95674-1", "Q92903-1", "P98191-1", "Q99L43-1" ], "evidence": [ { "id": "45664", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/45664" } ] }, { "id": "45668", "name": "", "equation": "1-octadecanoyl-2-(4Z,7Z,10Z,13Z,16Z,19Z-docosahexaenoyl)-sn-glycero-3-phosphate + CTP + H(+) = 1-octadecanoyl-2-(4Z,7Z,10Z,13Z,16Z,19Z-docosahexaenoyl)-sn-glycero-3-cytidine-5'-diphosphate + diphosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q91XU8-1", "O35052-1", "O95674-1", "Q92903-1", "P98191-1", "Q99L43-1" ], "evidence": [ { "id": "45668", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/45668" } ] }, { "id": "45672", "name": "", "equation": "1,2-di-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphate + CTP + H(+) = 1,2-di-(9Z,12Z-octadecadienoyl)-sn-glycero-3-cytidine-5'-diphosphate + diphosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O35052-1", "Q91XU8-1", "O95674-1", "Q92903-1", "P98191-1", "Q99L43-1" ], "evidence": [ { "id": "45672", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/45672" } ] }, { "id": "45676", "name": "", "equation": "1,2-di-(9Z-octadecenoyl)-sn-glycero-3-phosphate + CTP + H(+) = 1,2-di-(9Z-octadecenoyl)-sn-glycero-3-cytidine-5'-diphosphate + diphosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O35052-1", "Q91XU8-1", "O95674-1", "Q92903-1", "P98191-1", "Q99L43-1" ], "evidence": [ { "id": "45676", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/45676" } ] }, { "id": "R-RNO-1483165", "name": "PA is converted to CDP-DAG by CDS2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial inner membrane, mitochondrial matrix", "input_participant_list": [ "R-ALL-110577" ], "output_participant_list": [ "R-ALL-1524064" ], "enzyme_list": [ "Q91XU8-1" ], "evidence": [ { "id": "R-RNO-1483165", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1483165" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-110577", "participant_name": "CTP [mitochondrial matrix]", "crossref": [ { "id": "C00063", "database": "COMPOUND", "url": "" }, { "id": "000003861746", "database": "ZINC", "url": "" }, { "id": "37563", "database": "ChEBI", "url": "" }, { "id": "37563", "database": "ChEBI", "url": "" }, { "id": "000003861746", "database": "ZINC", "url": "" }, { "id": "C00063", "database": "COMPOUND", "url": "" }, { "id": "37563", "database": "ChEBI", "url": "" }, { "id": "000003861746", "database": "ZINC", "url": "" }, { "id": "C00063", "database": "COMPOUND", "url": "" }, { "id": "000003861746", "database": "ZINC", "url": "" }, { "id": "C00063", "database": "COMPOUND", "url": "" }, { "id": "37563", "database": "ChEBI", "url": "" }, { "id": "C00063", "database": "COMPOUND", "url": "" }, { "id": "37563", "database": "ChEBI", "url": "" }, { "id": "000003861746", "database": "ZINC", "url": "" }, { "id": "37563", "database": "ChEBI", "url": "" }, { "id": "000003861746", "database": "ZINC", "url": "" }, { "id": "C00063", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-1524064", "participant_name": "CDP-DAG [mitochondrial inner membrane]", "crossref": [ { "id": "C00269", "database": "COMPOUND", "url": "" }, { "id": "58332", "database": "ChEBI", "url": "" }, { "id": "C00269", "database": "COMPOUND", "url": "" }, { "id": "58332", "database": "ChEBI", "url": "" }, { "id": "C00269", "database": "COMPOUND", "url": "" }, { "id": "58332", "database": "ChEBI", "url": "" }, { "id": "C00269", "database": "COMPOUND", "url": "" }, { "id": "58332", "database": "ChEBI", "url": "" }, { "id": "C00269", "database": "COMPOUND", "url": "" }, { "id": "58332", "database": "ChEBI", "url": "" }, { "id": "C00269", "database": "COMPOUND", "url": "" }, { "id": "58332", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "D3ZKT0", "gene_name": "Tamm41", "activity": [ { "ec_number": "2.7.7.41", "activity": "a 1,2-diacyl-sn-glycero-3-phosphate + CTP + H(+) = a CDP-1,2-diacyl-sn-glycerol + diphosphate.", "evidence": [ { "id": "D3ZKT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZKT0" } ] }, { "ec_number": "2.7.7.41", "activity": "", "evidence": [ { "id": "D3ZKT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZKT0" } ] } ] }, { "uniprot_ac": "O35052", "gene_name": "Cds1", "activity": [ { "ec_number": "2.7.7.41", "activity": "a 1,2-diacyl-sn-glycero-3-phosphate + CTP + H(+) = a CDP-1,2-diacyl-sn-glycerol + diphosphate.", "evidence": [ { "id": "O35052", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35052" } ] }, { "ec_number": "2.7.7.41", "activity": "", "evidence": [ { "id": "O35052", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35052" } ] } ] }, { "uniprot_ac": "O95674", "gene_name": "CDS2", "activity": [ { "ec_number": "2.7.7.41", "activity": "a 1,2-diacyl-sn-glycero-3-phosphate + CTP + H(+) = a CDP-1,2-diacyl-sn-glycerol + diphosphate.", "evidence": [ { "id": "O95674", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95674" } ] }, { "ec_number": "2.7.7.41", "activity": "", "evidence": [ { "id": "O95674", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95674" } ] } ] }, { "uniprot_ac": "P38221", "gene_name": "CDS1", "activity": [ { "ec_number": "2.7.7.41", "activity": "a 1,2-diacyl-sn-glycero-3-phosphate + CTP + H(+) = a CDP-1,2-diacyl-sn-glycerol + diphosphate.", "evidence": [ { "id": "P38221", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38221" } ] }, { "ec_number": "2.7.7.41", "activity": "", "evidence": [ { "id": "P38221", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38221" } ] } ] }, { "uniprot_ac": "P53230", "gene_name": "TAM41", "activity": [ { "ec_number": "2.7.7.41", "activity": "a 1,2-diacyl-sn-glycero-3-phosphate + CTP + H(+) = a CDP-1,2-diacyl-sn-glycerol + diphosphate.", "evidence": [ { "id": "P53230", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53230" } ] }, { "ec_number": "2.7.7.41", "activity": "", "evidence": [ { "id": "P53230", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53230" } ] } ] }, { "uniprot_ac": "P56079", "gene_name": "Cds", "activity": [ { "ec_number": "2.7.7.41", "activity": "a 1,2-diacyl-sn-glycero-3-phosphate + CTP + H(+) = a CDP-1,2-diacyl-sn-glycerol + diphosphate.", "evidence": [ { "id": "P56079", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56079" } ] }, { "ec_number": "2.7.7.41", "activity": "", "evidence": [ { "id": "P56079", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56079" } ] } ] }, { "uniprot_ac": "P98191", "gene_name": "Cds1", "activity": [ { "ec_number": "2.7.7.41", "activity": "a 1,2-diacyl-sn-glycero-3-phosphate + CTP + H(+) = a CDP-1,2-diacyl-sn-glycerol + diphosphate.", "evidence": [ { "id": "P98191", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P98191" } ] }, { "ec_number": "2.7.7.41", "activity": "", "evidence": [ { "id": "P98191", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P98191" } ] } ] }, { "uniprot_ac": "Q3TUH1", "gene_name": "Tamm41", "activity": [ { "ec_number": "2.7.7.41", "activity": "a 1,2-diacyl-sn-glycero-3-phosphate + CTP + H(+) = a CDP-1,2-diacyl-sn-glycerol + diphosphate.", "evidence": [ { "id": "Q3TUH1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TUH1" } ] }, { "ec_number": "2.7.7.41", "activity": "", "evidence": [ { "id": "Q3TUH1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TUH1" } ] } ] }, { "uniprot_ac": "Q550P4", "gene_name": "", "activity": [ { "ec_number": "2.7.7.41", "activity": "a 1,2-diacyl-sn-glycero-3-phosphate + CTP + H(+) = a CDP-1,2-diacyl-sn-glycerol + diphosphate.", "evidence": [ { "id": "Q550P4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q550P4" } ] }, { "ec_number": "2.7.7.41", "activity": "", "evidence": [ { "id": "Q550P4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q550P4" } ] } ] }, { "uniprot_ac": "Q55D90", "gene_name": "cdsA", "activity": [ { "ec_number": "2.7.7.41", "activity": "a 1,2-diacyl-sn-glycero-3-phosphate + CTP + H(+) = a CDP-1,2-diacyl-sn-glycerol + diphosphate.", "evidence": [ { "id": "Q55D90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55D90" } ] }, { "ec_number": "2.7.7.41", "activity": "", "evidence": [ { "id": "Q55D90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55D90" } ] } ] }, { "uniprot_ac": "Q8INF2", "gene_name": "", "activity": [ { "ec_number": "2.7.7.41", "activity": "a 1,2-diacyl-sn-glycero-3-phosphate + CTP + H(+) = a CDP-1,2-diacyl-sn-glycerol + diphosphate.", "evidence": [ { "id": "Q8INF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8INF2" } ] }, { "ec_number": "2.7.7.41", "activity": "", "evidence": [ { "id": "Q8INF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8INF2" } ] } ] }, { "uniprot_ac": "Q91XU8", "gene_name": "Cds2", "activity": [ { "ec_number": "2.7.7.41", "activity": "a 1,2-diacyl-sn-glycero-3-phosphate + CTP + H(+) = a CDP-1,2-diacyl-sn-glycerol + diphosphate.", "evidence": [ { "id": "Q91XU8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91XU8" } ] }, { "ec_number": "2.7.7.41", "activity": "", "evidence": [ { "id": "Q91XU8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91XU8" } ] } ] }, { "uniprot_ac": "Q92903", "gene_name": "CDS1", "activity": [ { "ec_number": "2.7.7.41", "activity": "a 1,2-diacyl-sn-glycero-3-phosphate + CTP + H(+) = a CDP-1,2-diacyl-sn-glycerol + diphosphate.", "evidence": [ { "id": "Q92903", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92903" } ] }, { "ec_number": "2.7.7.41", "activity": "", "evidence": [ { "id": "Q92903", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92903" } ] } ] }, { "uniprot_ac": "Q96BW9", "gene_name": "TAMM41", "activity": [ { "ec_number": "2.7.7.41", "activity": "a 1,2-diacyl-sn-glycero-3-phosphate + CTP + H(+) = a CDP-1,2-diacyl-sn-glycerol + diphosphate.", "evidence": [ { "id": "Q96BW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96BW9" } ] }, { "ec_number": "2.7.7.41", "activity": "", "evidence": [ { "id": "Q96BW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96BW9" } ] } ] }, { "uniprot_ac": "Q99L43", "gene_name": "Cds2", "activity": [ { "ec_number": "2.7.7.41", "activity": "a 1,2-diacyl-sn-glycero-3-phosphate + CTP + H(+) = a CDP-1,2-diacyl-sn-glycerol + diphosphate.", "evidence": [ { "id": "Q99L43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99L43" } ] }, { "ec_number": "2.7.7.41", "activity": "", "evidence": [ { "id": "Q99L43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99L43" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }