{ "uniprot_canonical_ac": "Q91XQ5-1", "uniprot_ac": "Q91XQ5", "uniprot_id": "CHSTF_MOUSE", "mass": { "chemical_mass": 64986.0, "monoisotopic_mass": 64986.0 }, "refseq": { "ac": "NP_084211", "name": "carbohydrate sulfotransferase 15", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084211" }, "gene_names": [ { "name": "Chst15", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q91XQ5", "id": "Q91XQ5" }, { "name": "4631426J05Rik; BRAG; GalNAc4S-6ST; GalNAcS-6ST; MAd5; mKIAA0598", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084211", "id": "NP_084211" }, { "name": "Brag", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q91XQ5", "id": "Q91XQ5" }, { "name": "Chst15", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084211", "id": "NP_084211" }, { "name": "Galnac4s6st", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q91XQ5", "id": "Q91XQ5" }, { "name": "Kiaa0598", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q91XQ5", "id": "Q91XQ5" } ], "protein_names": [ { "name": "Carbohydrate sulfotransferase 15", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q91XQ5" }, { "name": "2.8.2.33", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91XQ5" }, { "name": "B-cell RAG-associated gene protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91XQ5" }, { "name": "GalNAc 4-sulfate 6-O-sulfotransferase; B-cell RAG-associated gene protein; N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase; carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084211", "id": "NP_084211" }, { "name": "GalNAc4S-6ST", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91XQ5" }, { "name": "N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91XQ5" }, { "name": "carbohydrate sulfotransferase 15", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084211", "id": "NP_084211" } ], "function": [ { "annotation": "Blockade CHST15 represses colonic fibrosis Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_084211", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084211" }, { "database": "PubMed", "id": "27410685", "url": "https://glygen.org/publication/PubMed/27410685" } ] }, { "annotation": "GalNAc4S-6ST has a role during early mouse development", "evidence": [ { "database": "RefSeq", "id": "NP_084211", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084211" }, { "database": "PubMed", "id": "17051481", "url": "https://glygen.org/publication/PubMed/17051481" } ] }, { "annotation": "Reconsideration of the Semaphorin-3A Binding Motif Found in Chondroitin Sulfate Using Galnac4s-6st-Knockout Mice. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_084211", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084211" }, { "database": "PubMed", "id": "33143303", "url": "https://glygen.org/publication/PubMed/33143303" } ] }, { "annotation": "Sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found in thrombomodulin chondroitin sulfate. May also act as a B-cell receptor involved in BCR ligation-mediated early activation that mediate regulatory signals key to B-cell development and/or regulation of B-cell-specific RAG expression; however such results are unclear in vivo (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q91XQ5", "url": "https://www.uniprot.org/uniprot/Q91XQ5#function" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs582161080", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs582161080" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 128, "end_pos": 128, "sequence_org": "P", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NLS).", "chr_id": "7", "chr_pos": "131871897", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P128", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q91XQ5", "url": "https://www.uniprot.org/uniprot/Q91XQ5" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Chst15", "url": "https://www.uniprot.org/uniprot/Q91XQ5", "locus": { "chromosome": "7", "start_pos": 131837509, "end_pos": 131918957, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000030930", "url": "https://www.ensembl.org/id/ENSMUSG00000030930" } ] } } ], "crossref": [ { "id": "ENSMUSG00000030930", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000030930", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "2.8.2.33", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.8.2.33&UniProtAcc=Q91XQ5", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "77590", "url": "https://www.ncbi.nlm.nih.gov/gene/77590", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0007088", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0007088", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:77590", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:77590", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1924840", "url": "http://www.informatics.jax.org/marker/MGI:1924840", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "HVDSKQM", "url": "https://omabrowser.org/oma/group/HVDSKQM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3939141at2759", "url": "http://www.orthodb.org/?query=3939141at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15723", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15723", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15723:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15723:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13469", "url": "http://pfam.xfam.org/family/PF13469", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q91XQ5", "url": "http://purl.obolibrary.org/obo/PR_Q91XQ5", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2022870", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_084211", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084211", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "54300", "url": "https://www.rhea-db.org/rhea/54300", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "54304", "url": "https://www.rhea-db.org/rhea/54304", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q91XQ5", "url": "https://www.uniprot.org/uniprot/Q91XQ5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q91XQ5-1", "url": "https://www.uniprot.org/uniprot/Q91XQ5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRHCINCCVQLFPEDTHKQQVACQGGPHHSHQACPTCKGENKILFRVDSKQMNLLAVLEVRTEGNENWGGFLRFRKGKRCSLVFGLIIMTLVMASYILSGAHQELLISSPFHYGGFPSNPSVMDGENPSDVKEHHYQPSVNNISYVKDYPSIKLIIDSIAARIEFTTRQLPDLQDLKRQELHMFSVIPSKFLPTSKSPCWYEEFSGRNTTDPYLTNSYVLYSKRFRSTFDALRKVFWGHLSHVQGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQAASAEQPSKMNKIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPEAKLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLTVFSKEQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNTRRPEDRSLGPMWPITQKILREFYGPFNTRLAQVLDDEAFAWKTT", "length": 561, "header": "sp|Q91XQ5-1|CHSTF_MOUSE Isoform 1 of Carbohydrate sulfotransferase 15 OS=Mus musculus OX=10090 GN=Chst15 PE=2 SV=1 CANONICAL=Q91XQ5-1" }, "isoforms": [ { "isoform_ac": "Q91XQ5-1", "url": "", "sequence": { "sequence": "MRHCINCCVQLFPEDTHKQQVACQGGPHHSHQACPTCKGENKILFRVDSKQMNLLAVLEVRTEGNENWGGFLRFRKGKRCSLVFGLIIMTLVMASYILSGAHQELLISSPFHYGGFPSNPSVMDGENPSDVKEHHYQPSVNNISYVKDYPSIKLIIDSIAARIEFTTRQLPDLQDLKRQELHMFSVIPSKFLPTSKSPCWYEEFSGRNTTDPYLTNSYVLYSKRFRSTFDALRKVFWGHLSHVQGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQAASAEQPSKMNKIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPEAKLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLTVFSKEQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNTRRPEDRSLGPMWPITQKILREFYGPFNTRLAQVLDDEAFAWKTT", "length": 561, "header": "sp|Q91XQ5-1|CHSTF_MOUSE Isoform 1 of Carbohydrate sulfotransferase 15 OS=Mus musculus OX=10090 GN=Chst15 PE=2 SV=1 CANONICAL=Q91XQ5-1" }, "locus": { "chromosome": "7", "start_pos": 131872279, "end_pos": 131840006, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000080215", "url": "https://www.ensembl.org/id/ENSMUST00000080215" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000079105", "url": "https://www.ensembl.org/id/ENSMUSP00000079105" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 364, "start_aa": "Asn", "end_pos": 364, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn364", "evidence": [ { "id": "Q91XQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91XQ5#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase expression during early mouse embryonic development.", "journal": "The International journal of developmental biology", "date": "2006", "authors": "Salgueiro AM, Filipe M, Belo JA", "evidence": [ { "database": "RefSeq", "id": "NP_084211", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084211" } ], "reference": [ { "type": "PubMed", "id": "17051481", "url": "https://glygen.org/publication/PubMed/17051481" } ] }, { "title": "Pivotal Role of Carbohydrate Sulfotransferase 15 in Fibrosis and Mucosal Healing in Mouse Colitis.", "journal": "PloS one", "date": "2016", "authors": "Suzuki K, Arumugam S, Yokoyama J, Kawauchi Y, Honda Y, Sato H, Aoyagi Y, Terai S, Okazaki K, Suzuki Y, Mizumoto S, Sugahara K, Atreya R, Neurath MF, Watanabe K, Hashiguchi T, Yoneyama H, Asakura H", "evidence": [ { "database": "RefSeq", "id": "NP_084211", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084211" } ], "reference": [ { "type": "PubMed", "id": "27410685", "url": "https://glygen.org/publication/PubMed/27410685" } ] }, { "title": "Reconsideration of the Semaphorin-3A Binding Motif Found in Chondroitin Sulfate Using Galnac4s-6st-Knockout Mice.", "journal": "Biomolecules", "date": "2020", "authors": "Nadanaka S, Miyata S, Yaqiang B, Tamura JI, Habuchi O, Kitagawa H", "evidence": [ { "database": "RefSeq", "id": "NP_084211", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084211" } ], "reference": [ { "type": "PubMed", "id": "33143303", "url": "https://glygen.org/publication/PubMed/33143303" } ] }, { "title": "hBRAG, a novel B cell lineage cDNA encoding a type II transmembrane glycoprotein potentially involved in the regulation of recombination activating gene 1 (RAG1).", "journal": "Eur. J. Immunol.", "date": "1998", "authors": "Verkoczy LK, Marsden PA, Berinstein NL", "evidence": [ { "database": "UniProtKB", "id": "Q91XQ5", "url": "https://www.uniprot.org/uniprot/Q91XQ5" } ], "reference": [ { "type": "PubMed", "id": "9754571", "url": "https://glygen.org/publication/PubMed/9754571" } ] } ], "pathway": [ { "id": "mmu:77590", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:77590", "resource": "KEGG Pathway" }, { "id": "R-MMU-2022870", "name": "Chondroitin sulfate biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2022870", "resource": "Reactome", "description": "Chondroitin sulfate biosynthesis" } ], "orthologs": [ { "uniprot_canonical_ac": "Q7LFX5-1", "protein_name": "Carbohydrate sulfotransferase 15", "gene_name": "CHST15", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRHCINCCIQLLPDGAHKQQVNCQGGPHHGHQACPTCKGENKILFRVDSKQMNLLAVLEVRTEGNENWGGFLRFKKGKRCSLVFGLIIMTLVMASYILSGAHQELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSVNNISYMKDYPSIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCWYEEFSGQNTTDPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQVLADEAFAWKTT", "length": 561 }, "evidence": [ { "id": "45238664", "url": "http://www.informatics.jax.org/homology/45238664", "database": "MGI" }, { "id": "Q91XQ5", "url": "https://omabrowser.org/oma/group/Q91XQ5/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8CHI9-1", "protein_name": "Carbohydrate sulfotransferase 15", "gene_name": "Chst15", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRHCINCCIQLFPEDAHKQQVACQGGPHHSHQACPSCKGEDKILFRVDSKQMNLLAVLEVRTEGNENWGGFLRFRKGKRCSLVFGLIIMTLVMASYILSGAHQELLISSPFHYGGFPSNPSVMDSESPSDVKEHHYQPSVNNISYVKDYPNIKLIIDSIAARNEFTTRQLPDLQDLKRQELHMFSVIPNKFLPTSKSPCWYEEFSGRNTTDPYLTNSYVLYSKRFRSTFDTLRKAFWGHLSHVHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQAASAEQTSKMNRIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPEAKLLVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLTVFSKEQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNTRRPEDRSLGPMWPITQKILRDFYGPFNTRLAQVLDDEAFAWKTT", "length": 561 }, "evidence": [ { "id": "45238664", "url": "http://www.informatics.jax.org/homology/45238664", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "hexose biosynthetic process", "id": "GO:0019319", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019319", "evidence": [ { "database": "UniProtKB", "id": "Q91XQ5", "url": "https://www.uniprot.org/uniprot/Q91XQ5" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "3'-phosphoadenosine 5'-phosphosulfate binding", "id": "GO:0050656", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050656", "evidence": [ { "database": "UniProtKB", "id": "Q91XQ5", "url": "https://www.uniprot.org/uniprot/Q91XQ5" } ], "pmid": "" }, { "name": "N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase activity", "id": "GO:0050659", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050659", "evidence": [ { "database": "UniProtKB", "id": "Q91XQ5", "url": "https://www.uniprot.org/uniprot/Q91XQ5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "Q91XQ5", "url": "https://www.uniprot.org/uniprot/Q91XQ5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 142, "end_pos": 144, "annotation": "n_glycosylation_sequon" }, { "start_pos": 208, "end_pos": 210, "annotation": "n_glycosylation_sequon" }, { "start_pos": 364, "end_pos": 366, "annotation": "n_glycosylation_sequon" }, { "start_pos": 409, "end_pos": 411, "annotation": "n_glycosylation_sequon" }, { "start_pos": 441, "end_pos": 443, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "54300", "name": "", "equation": "n 3'-phosphoadenylyl sulfate + chondroitin 4'-sulfate = n adenosine 3',5'-bisphosphate + chondroitin 4',6'-bissulfate + n H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8CHI9-1", "Q7LFX5-1", "Q91XQ5-1" ], "evidence": [ { "id": "54300", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/54300" } ] }, { "id": "54304", "name": "", "equation": "n 3'-phosphoadenylyl sulfate + dermatan 4'-sulfate = n adenosine 3',5'-bisphosphate + dermatan 4',6'-bissulfate + n H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8CHI9-1", "Q7LFX5-1", "Q91XQ5-1" ], "evidence": [ { "id": "54304", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/54304" } ] }, { "id": "R-MMU-2018659", "name": "Chondroitin 4-sulfate (C4S) can be further sulfated on position 6 by CHST15", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q91XQ5-1" ], "evidence": [ { "id": "R-MMU-2018659", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2018659" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "Q7LFX5", "gene_name": "CHST15", "activity": [ { "ec_number": "2.8.2.33", "activity": "n 3'-phosphoadenylyl sulfate + dermatan 4'-sulfate = n adenosine 3',5'-bisphosphate + dermatan 4',6'-bissulfate + n H(+).", "evidence": [ { "id": "Q7LFX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7LFX5" } ] }, { "ec_number": "2.8.2.33", "activity": "", "evidence": [ { "id": "Q7LFX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7LFX5" } ] } ] }, { "uniprot_ac": "Q8CHI9", "gene_name": "Chst15", "activity": [ { "ec_number": "2.8.2.33", "activity": "n 3'-phosphoadenylyl sulfate + dermatan 4'-sulfate = n adenosine 3',5'-bisphosphate + dermatan 4',6'-bissulfate + n H(+).", "evidence": [ { "id": "Q8CHI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CHI9" } ] }, { "ec_number": "2.8.2.33", "activity": "", "evidence": [ { "id": "Q8CHI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CHI9" } ] } ] }, { "uniprot_ac": "Q91XQ5", "gene_name": "Chst15", "activity": [ { "ec_number": "2.8.2.33", "activity": "n 3'-phosphoadenylyl sulfate + dermatan 4'-sulfate = n adenosine 3',5'-bisphosphate + dermatan 4',6'-bissulfate + n H(+).", "evidence": [ { "id": "Q91XQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91XQ5" } ] }, { "ec_number": "2.8.2.33", "activity": "", "evidence": [ { "id": "Q91XQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91XQ5" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }