{ "uniprot_canonical_ac": "Q91UZ5-1", "uniprot_ac": "Q91UZ5", "uniprot_id": "IMPA2_MOUSE", "mass": { "chemical_mass": 31716.0, "monoisotopic_mass": 31716.0 }, "refseq": { "ac": "NP_444491", "name": "inositol monophosphatase 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444491" }, "gene_names": [ { "name": "Impa2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q91UZ5", "id": "Q91UZ5" }, { "name": "2210415D20Rik; IMP 2; IMPase 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444491", "id": "NP_444491" }, { "name": "Impa2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444491", "id": "NP_444491" } ], "protein_names": [ { "name": "Inositol monophosphatase 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q91UZ5" }, { "name": "3.1.3.25", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91UZ5" }, { "name": "IMP 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91UZ5" }, { "name": "IMPase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91UZ5" }, { "name": "Inositol-1(or 4)-monophosphatase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91UZ5" }, { "name": "Myo-inositol monophosphatase A2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q91UZ5" }, { "name": "inositol monophosphatase 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444491", "id": "NP_444491" }, { "name": "myo-inositol monophosphatase A2; inositol (myo)-1(or 4)-monophosphatase 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444491", "id": "NP_444491" } ], "function": [ { "annotation": "Can use myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates. Has been implicated as the pharmacological target for lithium Li(+) action in brain (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q91UZ5", "url": "https://www.uniprot.org/uniprot/Q91UZ5#function" }, { "database": "UniProtKB", "id": "O14732", "url": "https://www.uniprot.org/uniprot/O14732#function" } ] }, { "annotation": "IMPA2 has a separate function in vivo from that of IMPA1", "evidence": [ { "database": "RefSeq", "id": "NP_444491", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444491" }, { "database": "PubMed", "id": "17068342", "url": "https://glygen.org/publication/PubMed/17068342" } ] } ], "disease": [ { "disease_id": "DOID:3312", "recommended_name": { "id": "DOID:3312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3312", "name": "bipolar disorder", "description": "A mood disorder that involves alternating periods of mania and depression." }, "synonyms": [ { "id": "DOID:3312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3312", "name": "Manic Bipolar Affective disorder", "description": "" }, { "id": "DOID:3312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3312", "name": "Manic Depressive disorder", "description": "" }, { "id": "DOID:3312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3312", "name": "Manic bipolar I disorder", "description": "" }, { "id": "DOID:3312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3312", "name": "bipolar depression", "description": "" }, { "id": "DOID:3312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3312", "name": "bipolar disorder manic phase", "description": "" }, { "id": "DOID:3312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3312", "name": "manic depression", "description": "" }, { "id": "DOID:3312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3312", "name": "manic disorder", "description": "" }, { "id": "DOID:3312", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3312", "name": "mixed bipolar disorder", "description": "" } ], "evidence": [ { "id": "3312", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3312" } ] }, { "disease_id": "DOID:5419", "recommended_name": { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia", "description": "A psychotic disorder that is characterized by a disintegration of thought processes and of emotional responsiveness." }, "synonyms": [ { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "A major psychotic disorder characterized by abnormalities in the perception or expression of reality. It affects the cognitive and psychomotor functions. Common clinical signs and symptoms include delusions, hallucinations, disorganized thinking, and retreat from reality." }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia 12", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia (disease)", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "SCZD", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizoaffective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia with or without an affective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia, susceptibility to", "description": "" }, { "id": "MIM:181500", "resource": "MIM", "url": "https://www.omim.org/entry/181500", "name": "Schizophrenia", "description": "Schizophrenia" } ], "evidence": [ { "id": "5419", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5419" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q91UZ5", "url": "https://www.uniprot.org/uniprot/Q91UZ5" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Impa2", "url": "https://www.uniprot.org/uniprot/Q91UZ5", "locus": { "chromosome": "18", "start_pos": 67455542, "end_pos": 67422256, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000024525", "url": "https://www.ensembl.org/id/ENSMUSG00000024525" } ] } } ], "crossref": [ { "id": "ENSMUSG00000024525", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000024525", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "3.1.3.25", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.1.3.25&UniProtAcc=Q91UZ5", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd01639", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01639", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "114663", "url": "https://www.ncbi.nlm.nih.gov/gene/114663", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000760", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000760", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020550", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020550", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020552", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020552", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020583", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020583", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033942", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033942", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:114663", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:114663", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2149728", "url": "http://www.informatics.jax.org/marker/MGI:2149728", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "NYTHIFP", "url": "https://omabrowser.org/oma/group/NYTHIFP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3685586at2759", "url": "http://www.orthodb.org/?query=3685586at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR20854", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20854", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR20854:SF29", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20854:SF29", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00459", "url": "http://pfam.xfam.org/family/PF00459", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q91UZ5", "url": "http://purl.obolibrary.org/obo/PR_Q91UZ5", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-1855183", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1855183", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_444491", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444491", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "24056", "url": "https://www.rhea-db.org/rhea/24056", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q91UZ5", "url": "https://www.uniprot.org/uniprot/Q91UZ5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q91UZ5-1", "url": "https://www.uniprot.org/uniprot/Q91UZ5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKPSSEEEGELVQGVGPWDECFEVAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHRVEDLIVSELRKRFPSHRFIAEEATASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVHQELEFGVIHHCTEERLYTGRRGQGAFCNGQRLQVSRETDLAKALVLTEIGPKRDPDTLKVFLSNMERLLHAKAHGVRVIGSSTLALCYLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMSCRVVAAGTREMAVLIAQALQTINYGRDDEK", "length": 290, "header": "sp|Q91UZ5-1|IMPA2_MOUSE Isoform 1 of Inositol monophosphatase 2 OS=Mus musculus OX=10090 GN=Impa2 PE=1 SV=1 CANONICAL=Q91UZ5-1" }, "isoforms": [ { "isoform_ac": "Q91UZ5-1", "url": "", "sequence": { "sequence": "MKPSSEEEGELVQGVGPWDECFEVAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHRVEDLIVSELRKRFPSHRFIAEEATASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVHQELEFGVIHHCTEERLYTGRRGQGAFCNGQRLQVSRETDLAKALVLTEIGPKRDPDTLKVFLSNMERLLHAKAHGVRVIGSSTLALCYLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMSCRVVAAGTREMAVLIAQALQTINYGRDDEK", "length": 290, "header": "sp|Q91UZ5-1|IMPA2_MOUSE Isoform 1 of Inositol monophosphatase 2 OS=Mus musculus OX=10090 GN=Impa2 PE=1 SV=1 CANONICAL=Q91UZ5-1" }, "locus": { "chromosome": "18", "start_pos": 67451577, "end_pos": 67422475, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000025403", "url": "https://www.ensembl.org/id/ENSMUST00000025403" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000025403", "url": "https://www.ensembl.org/id/ENSMUSP00000025403" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Characterization of two genes, Impa1 and Impa2 encoding mouse myo-inositol monophosphatases.", "journal": "Gene", "date": "2001", "authors": "Steen V.M., Sjoeholt G., Agam G., Shamir A., Ebstein R.P.", "evidence": [ { "database": "UniProtKB", "id": "Q91UZ5", "url": "https://www.uniprot.org/uniprot/Q91UZ5" } ], "reference": [ { "type": "PubMed", "id": "11418250", "url": "https://glygen.org/publication/PubMed/11418250" } ] }, { "title": "Spatial expression patterns and biochemical properties distinguish a second myo-inositol monophosphatase IMPA2 from IMPA1.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "Ohnishi T, Ohba H, Seo KC, Im J, Sato Y, Iwayama Y, Furuichi T, Chung SK, Yoshikawa T", "evidence": [ { "database": "UniProtKB", "id": "Q91UZ5", "url": "https://www.uniprot.org/uniprot/Q91UZ5" }, { "database": "RefSeq", "id": "NP_444491", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444491" } ], "reference": [ { "type": "PubMed", "id": "17068342", "url": "https://glygen.org/publication/PubMed/17068342" } ] } ], "pathway": [ { "id": "mmu:114663", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:114663", "resource": "KEGG Pathway" }, { "id": "R-MMU-1855183", "name": "Synthesis of IP2, IP, and Ins in the cytosol", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1855183", "resource": "Reactome", "description": "Synthesis of IP2, IP, and Ins in the cytosol" } ], "orthologs": [ { "uniprot_canonical_ac": "O14732-1", "protein_name": "Inositol monophosphatase 2", "gene_name": "IMPA2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK", "length": 288 }, "evidence": [ { "id": "45238322", "url": "http://www.informatics.jax.org/homology/45238322", "database": "MGI" }, { "id": "Q91UZ5", "url": "https://omabrowser.org/oma/group/Q91UZ5/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8CIN7-1", "protein_name": "Inositol monophosphatase 2", "gene_name": "Impa2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKPNSEEEEELVQGVGPWDECFEVAVQLALRAGQIIRKALTEEKHVSTKTSAADLVTETDHRVEDLIVSELRKRFPSHRFIAEEATASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVHQELEFGVIHHCTEERLYTGRRGQGAFCNGQRLQVSRETDLAKALVLTEIGPKRDPDTLKVFLSNMERLLHAKAHGVRVIGSSTLALCYLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMSCRVVAAGTREMAVLIAQALQTINYGRDDEK", "length": 290 }, "evidence": [ { "id": "45238322", "url": "http://www.informatics.jax.org/homology/45238322", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "inositol metabolic process", "id": "GO:0006020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006020", "evidence": [ { "database": "UniProtKB", "id": "Q91UZ5", "url": "https://www.uniprot.org/uniprot/Q91UZ5" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "Q91UZ5", "url": "https://www.uniprot.org/uniprot/Q91UZ5" } ], "pmid": "" }, { "name": "response to lithium ion", "id": "GO:0010226", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010226", "evidence": [ { "database": "UniProtKB", "id": "Q91UZ5", "url": "https://www.uniprot.org/uniprot/Q91UZ5" } ], "pmid": "" }, { "name": "inositol biosynthetic process", "id": "GO:0006021", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006021", "evidence": [ { "database": "UniProtKB", "id": "Q91UZ5", "url": "https://www.uniprot.org/uniprot/Q91UZ5" } ], "pmid": "" }, { "name": "phosphatidylinositol phosphate biosynthetic process", "id": "GO:0046854", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046854", "evidence": [ { "database": "UniProtKB", "id": "Q91UZ5", "url": "https://www.uniprot.org/uniprot/Q91UZ5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q91UZ5", "url": "https://www.uniprot.org/uniprot/Q91UZ5" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "Q91UZ5", "url": "https://www.uniprot.org/uniprot/Q91UZ5" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q91UZ5", "url": "https://www.uniprot.org/uniprot/Q91UZ5" } ], "pmid": "" }, { "name": "inositol monophosphate 1-phosphatase activity", "id": "GO:0008934", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008934", "evidence": [ { "database": "UniProtKB", "id": "Q91UZ5", "url": "https://www.uniprot.org/uniprot/Q91UZ5" } ], "pmid": "" }, { "name": "inositol monophosphate 3-phosphatase activity", "id": "GO:0052832", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052832", "evidence": [ { "database": "UniProtKB", "id": "Q91UZ5", "url": "https://www.uniprot.org/uniprot/Q91UZ5" } ], "pmid": "" }, { "name": "inositol monophosphate 4-phosphatase activity", "id": "GO:0052833", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052833", "evidence": [ { "database": "UniProtKB", "id": "Q91UZ5", "url": "https://www.uniprot.org/uniprot/Q91UZ5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "24056", "name": "", "equation": "a myo-inositol phosphate + H2O = myo-inositol + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8CIN7-1", "P97697-1", "P29218-1", "O14732-1", "Q9Y2H2-1", "O55023-1", "Q91UZ5-1", "Q8CDA1-1", "P38710-1", "Q05533-1", "Q54U72-1", "Q9VYF2-1", "Q7KTW5-1", "Q9VUW1-1", "Q9VUW2-1", "Q9VUW4-1", "Q9VP62-1", "Q9VUW3-1" ], "evidence": [ { "id": "24056", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/24056" } ] }, { "id": "R-MMU-1855154", "name": "I1P is dephosphorylated to Ins by IMPA1/2 in the cytosol", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-870330" ], "output_participant_list": [], "enzyme_list": [ "O55023-1", "Q91UZ5-1" ], "evidence": [ { "id": "R-MMU-1855154", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1855154" } ] }, { "id": "R-MMU-1855210", "name": "I3P is dephosphorylated to Ins by IMPA1/2 in the cytosol", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-1629731" ], "output_participant_list": [ "R-ALL-426910" ], "enzyme_list": [ "O55023-1", "Q91UZ5-1" ], "evidence": [ { "id": "R-MMU-1855210", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1855210" } ] }, { "id": "R-MMU-1855211", "name": "I4P is dephosphorylated to Ins by IMPA1/2 in the cytosol", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-1629753" ], "output_participant_list": [], "enzyme_list": [ "O55023-1", "Q91UZ5-1" ], "evidence": [ { "id": "R-MMU-1855211", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1855211" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-1629731", "participant_name": "I3P [cytosol]", "crossref": [ { "id": "C04006", "database": "COMPOUND", "url": "" }, { "id": "18169", "database": "ChEBI", "url": "" }, { "id": "5204", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0006814", "database": "HMDB Metabolite", "url": "" }, { "id": "000100028278", "database": "ZINC", "url": "" }, { "id": "18169", "database": "ChEBI", "url": "" }, { "id": "HMDB0006814", "database": "HMDB Metabolite", "url": "" }, { "id": "C04006", "database": "COMPOUND", "url": "" }, { "id": "000100028278", "database": "ZINC", "url": "" }, { "id": "5204", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "5204", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C04006", "database": "COMPOUND", "url": "" }, { "id": "000100028278", "database": "ZINC", "url": "" }, { "id": "18169", "database": "ChEBI", "url": "" }, { "id": "HMDB0006814", "database": "HMDB Metabolite", "url": "" }, { "id": "18169", "database": "ChEBI", "url": "" }, { "id": "HMDB0006814", "database": "HMDB Metabolite", "url": "" }, { "id": "000100028278", "database": "ZINC", "url": "" }, { "id": "5204", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C04006", "database": "COMPOUND", "url": "" }, { "id": "C04006", "database": "COMPOUND", "url": "" }, { "id": "18169", "database": "ChEBI", "url": "" }, { "id": "5204", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0006814", "database": "HMDB Metabolite", "url": "" }, { "id": "000100028278", "database": "ZINC", "url": "" }, { "id": "C04006", "database": "COMPOUND", "url": "" }, { "id": "18169", "database": "ChEBI", "url": "" }, { "id": "5204", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0006814", "database": "HMDB Metabolite", "url": "" }, { "id": "000100028278", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-1629753", "participant_name": "I4P [cytosol]", "crossref": [ { "id": "C03546", "database": "COMPOUND", "url": "" }, { "id": "18384", "database": "ChEBI", "url": "" }, { "id": "5205", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000100016164", "database": "ZINC", "url": "" }, { "id": "HMDB0001313", "database": "HMDB Metabolite", "url": "" }, { "id": "18384", "database": "ChEBI", "url": "" }, { "id": "000100016164", "database": "ZINC", "url": "" }, { "id": "HMDB0001313", "database": "HMDB Metabolite", "url": "" }, { "id": "C03546", "database": "COMPOUND", "url": "" }, { "id": "5205", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000100016164", "database": "ZINC", "url": "" }, { "id": "18384", "database": "ChEBI", "url": "" }, { "id": "HMDB0001313", "database": "HMDB Metabolite", "url": "" }, { "id": "5205", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C03546", "database": "COMPOUND", "url": "" }, { "id": "C03546", "database": "COMPOUND", "url": "" }, { "id": "5205", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0001313", "database": "HMDB Metabolite", "url": "" }, { "id": "18384", "database": "ChEBI", "url": "" }, { "id": "000100016164", "database": "ZINC", "url": "" }, { "id": "C03546", "database": "COMPOUND", "url": "" }, { "id": "18384", "database": "ChEBI", "url": "" }, { "id": "5205", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000100016164", "database": "ZINC", "url": "" }, { "id": "HMDB0001313", "database": "HMDB Metabolite", "url": "" }, { "id": "18384", "database": "ChEBI", "url": "" }, { "id": "000100016164", "database": "ZINC", "url": "" }, { "id": "HMDB0001313", "database": "HMDB Metabolite", "url": "" }, { "id": "5205", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C03546", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-426910", "participant_name": "Ins [cytosol]", "crossref": [ { "id": "C00137", "database": "COMPOUND", "url": "" }, { "id": "17268", "database": "ChEBI", "url": "" }, { "id": "000100018867", "database": "ZINC", "url": "" }, { "id": "HMDB0000211", "database": "HMDB Metabolite", "url": "" }, { "id": "4495", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00137", "database": "COMPOUND", "url": "" }, { "id": "17268", "database": "ChEBI", "url": "" }, { "id": "000100018867", "database": "ZINC", "url": "" }, { "id": "HMDB0000211", "database": "HMDB Metabolite", "url": "" }, { "id": "4495", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00137", "database": "COMPOUND", "url": "" }, { "id": "17268", "database": "ChEBI", "url": "" }, { "id": "000100018867", "database": "ZINC", "url": "" }, { "id": "HMDB0000211", "database": "HMDB Metabolite", "url": "" }, { "id": "4495", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00137", "database": "COMPOUND", "url": "" }, { "id": "17268", "database": "ChEBI", "url": "" }, { "id": "000100018867", "database": "ZINC", "url": "" }, { "id": "HMDB0000211", "database": "HMDB Metabolite", "url": "" }, { "id": "4495", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00137", "database": "COMPOUND", "url": "" }, { "id": "17268", "database": "ChEBI", "url": "" }, { "id": "000100018867", "database": "ZINC", "url": "" }, { "id": "HMDB0000211", "database": "HMDB Metabolite", "url": "" }, { "id": "4495", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00137", "database": "COMPOUND", "url": "" }, { "id": "17268", "database": "ChEBI", "url": "" }, { "id": "000100018867", "database": "ZINC", "url": "" }, { "id": "HMDB0000211", "database": "HMDB Metabolite", "url": "" }, { "id": "4495", "database": "Guide to Pharmacology - Ligands", "url": "" } ] }, { "participant_id": "R-ALL-870330", "participant_name": "I1P [cytosol]", "crossref": [ { "id": "18297", "database": "ChEBI", "url": "" }, { "id": "HMDB0000213", "database": "HMDB Metabolite", "url": "" }, { "id": "000100061358", "database": "ZINC", "url": "" }, { "id": "5203", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C01177", "database": "COMPOUND", "url": "" }, { "id": "000100061358", "database": "ZINC", "url": "" }, { "id": "18297", "database": "ChEBI", "url": "" }, { "id": "C01177", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000213", "database": "HMDB Metabolite", "url": "" }, { "id": "5203", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "5203", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0000213", "database": "HMDB Metabolite", "url": "" }, { "id": "C01177", "database": "COMPOUND", "url": "" }, { "id": "000100061358", "database": "ZINC", "url": "" }, { "id": "18297", "database": "ChEBI", "url": "" }, { "id": "5203", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0000213", "database": "HMDB Metabolite", "url": "" }, { "id": "C01177", "database": "COMPOUND", "url": "" }, { "id": "18297", "database": "ChEBI", "url": "" }, { "id": "000100061358", "database": "ZINC", "url": "" }, { "id": "18297", "database": "ChEBI", "url": "" }, { "id": "HMDB0000213", "database": "HMDB Metabolite", "url": "" }, { "id": "000100061358", "database": "ZINC", "url": "" }, { "id": "5203", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C01177", "database": "COMPOUND", "url": "" }, { "id": "18297", "database": "ChEBI", "url": "" }, { "id": "000100061358", "database": "ZINC", "url": "" }, { "id": "C01177", "database": "COMPOUND", "url": "" }, { "id": "5203", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0000213", "database": "HMDB Metabolite", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O14732", "gene_name": "IMPA2", "activity": [ { "ec_number": "3.1.3.25", "activity": "1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.", "evidence": [ { "id": "O14732", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14732" } ] }, { "ec_number": "3.1.3.25", "activity": "", "evidence": [ { "id": "O14732", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14732" } ] } ] }, { "uniprot_ac": "O55023", "gene_name": "Impa1", "activity": [ { "ec_number": "3.1.3.94", "activity": "alpha-D-galactose 1-phosphate + H2O = D-galactose + phosphate.", "evidence": [ { "id": "O55023", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55023" } ] }, { "ec_number": "3.1.3.25", "activity": "1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.", "evidence": [ { "id": "O55023", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55023" } ] }, { "ec_number": "3.1.3.25", "activity": "", "evidence": [ { "id": "O55023", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55023" } ] } ] }, { "uniprot_ac": "P29218", "gene_name": "IMPA1", "activity": [ { "ec_number": "3.1.3.94", "activity": "alpha-D-galactose 1-phosphate + H2O = D-galactose + phosphate.", "evidence": [ { "id": "P29218", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29218" } ] }, { "ec_number": "3.1.3.25", "activity": "1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.", "evidence": [ { "id": "P29218", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29218" } ] }, { "ec_number": "3.1.3.25", "activity": "", "evidence": [ { "id": "P29218", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29218" } ] } ] }, { "uniprot_ac": "P38710", "gene_name": "INM1", "activity": [ { "ec_number": "3.1.3.25", "activity": "1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.", "evidence": [ { "id": "P38710", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38710" } ] }, { "ec_number": "3.1.3.25", "activity": "", "evidence": [ { "id": "P38710", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38710" } ] } ] }, { "uniprot_ac": "P97697", "gene_name": "Impa1", "activity": [ { "ec_number": "3.1.3.25", "activity": "1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.", "evidence": [ { "id": "P97697", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97697" } ] }, { "ec_number": "3.1.3.25", "activity": "", "evidence": [ { "id": "P97697", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97697" } ] }, { "ec_number": "3.1.3.94", "activity": "alpha-D-galactose 1-phosphate + H2O = D-galactose + phosphate.", "evidence": [ { "id": "P97697", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97697" } ] } ] }, { "uniprot_ac": "Q05533", "gene_name": "INM2", "activity": [ { "ec_number": "3.1.3.25", "activity": "1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.", "evidence": [ { "id": "Q05533", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05533" } ] }, { "ec_number": "3.1.3.25", "activity": "", "evidence": [ { "id": "Q05533", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05533" } ] } ] }, { "uniprot_ac": "Q54U72", "gene_name": "impa1", "activity": [ { "ec_number": "3.1.3.94", "activity": "alpha-D-galactose 1-phosphate + H2O = D-galactose + phosphate.", "evidence": [ { "id": "Q54U72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54U72" } ] }, { "ec_number": "3.1.3.25", "activity": "1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.", "evidence": [ { "id": "Q54U72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54U72" } ] }, { "ec_number": "3.1.3.25", "activity": "", "evidence": [ { "id": "Q54U72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54U72" } ] } ] }, { "uniprot_ac": "Q7KTW5", "gene_name": "Dmel\\CG9391", "activity": [ { "ec_number": "3.1.3.25", "activity": "1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.", "evidence": [ { "id": "Q7KTW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KTW5" } ] }, { "ec_number": "3.1.3.25", "activity": "", "evidence": [ { "id": "Q7KTW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KTW5" } ] } ] }, { "uniprot_ac": "Q8CDA1", "gene_name": "Inpp5f", "activity": [ { "ec_number": "3.1.3.25", "activity": "1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.", "evidence": [ { "id": "Q8CDA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CDA1" } ] }, { "ec_number": "3.1.3.25", "activity": "", "evidence": [ { "id": "Q8CDA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CDA1" } ] } ] }, { "uniprot_ac": "Q8CIN7", "gene_name": "Impa2", "activity": [ { "ec_number": "3.1.3.25", "activity": "1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.", "evidence": [ { "id": "Q8CIN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIN7" } ] }, { "ec_number": "3.1.3.25", "activity": "", "evidence": [ { "id": "Q8CIN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIN7" } ] } ] }, { "uniprot_ac": "Q91UZ5", "gene_name": "Impa2", "activity": [ { "ec_number": "3.1.3.25", "activity": "1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.", "evidence": [ { "id": "Q91UZ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91UZ5" } ] }, { "ec_number": "3.1.3.25", "activity": "", "evidence": [ { "id": "Q91UZ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91UZ5" } ] } ] }, { "uniprot_ac": "Q9VP62", "gene_name": "Dmel\\CG9389", "activity": [ { "ec_number": "3.1.3.25", "activity": "1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.", "evidence": [ { "id": "Q9VP62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VP62" } ] }, { "ec_number": "3.1.3.25", "activity": "", "evidence": [ { "id": "Q9VP62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VP62" } ] } ] }, { "uniprot_ac": "Q9VUW1", "gene_name": "cg17026", "activity": [ { "ec_number": "3.1.3.25", "activity": "1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.", "evidence": [ { "id": "Q9VUW1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VUW1" } ] }, { "ec_number": "3.1.3.25", "activity": "", "evidence": [ { "id": "Q9VUW1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VUW1" } ] } ] }, { "uniprot_ac": "Q9VUW2", "gene_name": "IMP", "activity": [ { "ec_number": "3.1.3.25", "activity": "1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.", "evidence": [ { "id": "Q9VUW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VUW2" } ] }, { "ec_number": "3.1.3.25", "activity": "", "evidence": [ { "id": "Q9VUW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VUW2" } ] } ] }, { "uniprot_ac": "Q9VUW3", "gene_name": "IMP", "activity": [ { "ec_number": "3.1.3.25", "activity": "1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.", "evidence": [ { "id": "Q9VUW3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VUW3" } ] }, { "ec_number": "3.1.3.25", "activity": "", "evidence": [ { "id": "Q9VUW3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VUW3" } ] } ] }, { "uniprot_ac": "Q9VUW4", "gene_name": "IMP", "activity": [ { "ec_number": "3.1.3.25", "activity": "1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.", "evidence": [ { "id": "Q9VUW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VUW4" } ] }, { "ec_number": "3.1.3.25", "activity": "", "evidence": [ { "id": "Q9VUW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VUW4" } ] } ] }, { "uniprot_ac": "Q9VYF2", "gene_name": "", "activity": [ { "ec_number": "3.1.3.25", "activity": "1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.", "evidence": [ { "id": "Q9VYF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VYF2" } ] }, { "ec_number": "3.1.3.25", "activity": "", "evidence": [ { "id": "Q9VYF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VYF2" } ] }, { "ec_number": "3.1.3.57", "activity": "1D-myo-inositol 1,4-bisphosphate + H2O = 1D-myo-inositol 4-phosphate + phosphate.", "evidence": [ { "id": "Q9VYF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VYF2" } ] }, { "ec_number": "3.1.3.6", "activity": "a ribonucleoside 3'-phosphate + H2O = a ribonucleoside + phosphate.", "evidence": [ { "id": "Q9VYF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VYF2" } ] } ] }, { "uniprot_ac": "Q9Y2H2", "gene_name": "INPP5F", "activity": [ { "ec_number": "3.1.3.25", "activity": "1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.", "evidence": [ { "id": "Q9Y2H2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2H2" } ] }, { "ec_number": "3.1.3.25", "activity": "", "evidence": [ { "id": "Q9Y2H2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2H2" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }