{ "uniprot_canonical_ac": "Q8VI67-1", "uniprot_ac": "Q8VI67", "uniprot_id": "SP7_MOUSE", "mass": { "chemical_mass": 44718.0, "monoisotopic_mass": 44718.0 }, "refseq": { "ac": "XP_006520582", "name": "transcription factor Sp7 isoform X2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006520582" }, "gene_names": [ { "name": "Sp7", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8VI67", "id": "Q8VI67" }, { "name": "Osx", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q8VI67", "id": "Q8VI67" } ], "protein_names": [ { "name": "Transcription factor Sp7", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8VI67" }, { "name": "C22", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8VI67" }, { "name": "Zinc finger protein osterix", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8VI67" }, { "name": "transcription factor Sp7 isoform X2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006520582", "id": "XP_006520582" } ], "function": [ { "annotation": "Transcriptional activator essential for osteoblast differentiation (PubMed:11792318, PubMed:17510056, PubMed:30026585). Binds to SP1 and EKLF consensus sequences and to other G/C-rich sequences (PubMed:11792318, PubMed:17510056).", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67#function" }, { "database": "PubMed", "id": "30026585", "url": "https://glygen.org/publication/PubMed/30026585" }, { "database": "PubMed", "id": "17510056", "url": "https://glygen.org/publication/PubMed/17510056" }, { "database": "PubMed", "id": "11792318", "url": "https://glygen.org/publication/PubMed/11792318" } ] } ], "disease": [ { "disease_id": "DOID:0110348", "recommended_name": { "id": "DOID:0110348", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110348", "name": "osteogenesis imperfecta type 12", "description": "An osteogenesis imperfecta that has_material_basis_in mutation in the SP7 gene on chromosome 12q13." }, "synonyms": [ { "id": "DOID:0110348", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110348", "name": "OI12", "description": "" }, { "id": "DOID:0110348", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110348", "name": "osteogenesis imperfecta type XII", "description": "" }, { "id": "MONDO:0013460", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013460", "name": "osteogenesis imperfecta type 12", "description": "Any osteogenesis imperfecta in which the cause of the disease is a mutation in the SP7 gene." }, { "id": "MONDO:0013460", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013460", "name": "OI12", "description": "" }, { "id": "MONDO:0013460", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013460", "name": "SP7 osteogenesis imperfecta", "description": "" }, { "id": "MONDO:0013460", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013460", "name": "osteogenesis imperfecta caused by mutation in SP7", "description": "" }, { "id": "MONDO:0013460", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013460", "name": "osteogenesis imperfecta type XII", "description": "" }, { "id": "MONDO:0013460", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013460", "name": "OI, type 12", "description": "" }, { "id": "MONDO:0013460", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013460", "name": "osteogenesis imperfecta, type 12", "description": "" }, { "id": "MONDO:0013460", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013460", "name": "osteogenesis imperfecta, type XII", "description": "" }, { "id": "MIM:613849", "resource": "MIM", "url": "https://www.omim.org/entry/613849", "name": "Osteogenesis imperfecta 12", "description": "Osteogenesis imperfecta 12" } ], "evidence": [ { "id": "0110348", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0110348" } ] }, { "disease_id": "DOID:1712", "recommended_name": { "id": "DOID:1712", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1712", "name": "aortic valve stenosis", "description": "An aortic valve disease that is characterized by narrowing of the heart's aortic valve opening." }, "synonyms": [ { "id": "DOID:1712", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1712", "name": "Aortic stenosis", "description": "" }, { "id": "DOID:1712", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1712", "name": "Rheumatic aortic stenosis", "description": "" }, { "id": "DOID:1712", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1712", "name": "rheumatic aortic valve stenosis", "description": "" } ], "evidence": [ { "id": "1712", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1712" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 368, "end_pos": 368, "sequence_org": "K", "sequence_mut": "R", "comment": "Decreased propionylation, leading to increased transcription activator activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" }, { "database": "PubMed", "id": "30026585", "url": "https://glygen.org/publication/PubMed/30026585" } ] }, { "start_pos": 41, "end_pos": 46, "sequence_org": "KGGTKK", "sequence_mut": "RGGTRR", "comment": "Decreased propionylation.", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" }, { "database": "PubMed", "id": "30026585", "url": "https://glygen.org/publication/PubMed/30026585" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Sp7", "url": "https://www.uniprot.org/uniprot/Q8VI67", "locus": { "chromosome": "15", "start_pos": 102265041, "end_pos": 102275617, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000060284", "url": "https://www.ensembl.org/id/ENSMUSG00000060284" } ] } } ], "crossref": [ { "id": "ENSMUSG00000060284", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000060284", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "170574", "url": "https://www.ncbi.nlm.nih.gov/gene/170574", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q8VI67", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q8VI67*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:170574", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:170574", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2153568", "url": "http://www.informatics.jax.org/marker/MGI:2153568", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q8VI67", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8VI67", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "NTPSPWW", "url": "https://omabrowser.org/oma/group/NTPSPWW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5359201at2759", "url": "http://www.orthodb.org/?query=5359201at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23235", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23235", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23235:SF19", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23235:SF19", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00096", "url": "http://pfam.xfam.org/family/PF00096", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8VI67", "url": "http://purl.obolibrary.org/obo/PR_Q8VI67", "database": "PRO", "categories": [ "Protein" ] }, { "id": "XP_006520582", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006520582", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q5RM08", "url": "https://www.uniprot.org/uniprot/Q5RM08", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5RM08-1", "url": "https://www.uniprot.org/uniprot/Q5RM08-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8VI67-1", "url": "https://www.uniprot.org/uniprot/Q8VI67-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASSLLEEEAHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKGGTKKPYADLSAPKTMGDAYPAPFSSTNGLLSPAGSPPAPASGYANDYPPFPHSFPGPTGAQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQGTLSTGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSGQLEGSGAAKPPRGAGTGGSGGYAGSGAGRSTCDCPNCQELERLGAAAAGLRKKPIHSCHIPGCGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELERHVRTHTREKKFTCLLCSKRFTRSDHLSKHQRTHGEPGPGPPPSGPKELGEGRSVGEEEANQPPRSSTSPAPPEKAHGGSPEQSNLLEI", "length": 428, "header": "sp|Q8VI67-1|SP7_MOUSE Isoform 1 of Transcription factor Sp7 OS=Mus musculus OX=10090 GN=Sp7 PE=1 SV=1 CANONICAL=Q8VI67-1" }, "isoforms": [ { "isoform_ac": "Q5RM08-1", "url": "", "sequence": { "sequence": "MLTAACSKFGGSSPLRDSTTLGKGGTKKPYADLSAPKTMGDAYPAPFSSTNGLLSPAGSPPAPASGYANDYPPFPHSFPGPTGAQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQGTLSTGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSGQLEGSGAAKPPRGAGTGGSGGYAGSGAGRSTCDCPNCQELERLGAAAAGLRKKPIHSCHIPGCGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELERHVRTHTREKKFTCLLCSKRFTRSDHLSKHQRTHGEPGPGPPPSGPKELGEGRSVGEEEANQPPRSSTSPAPPEKAHGGSPEQSNLLEI", "length": 410, "header": "tr|Q5RM08-1|Q5RM08_MOUSE Computationally mapped isoform of Osterix OS=Mus musculus OX=10090 GN=Sp7 PE=1 SV=1 CANONICAL=Q8VI67-1" }, "locus": { "chromosome": "15", "start_pos": 102267804, "end_pos": 102266575, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000229464.2", "url": "https://www.ensembl.org/id/ENSMUST00000229464.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000154859.2", "url": "https://www.ensembl.org/id/ENSMUSP00000154859.2" } ] } }, { "isoform_ac": "Q8VI67-1", "url": "", "sequence": { "sequence": "MASSLLEEEAHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKGGTKKPYADLSAPKTMGDAYPAPFSSTNGLLSPAGSPPAPASGYANDYPPFPHSFPGPTGAQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQGTLSTGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSGQLEGSGAAKPPRGAGTGGSGGYAGSGAGRSTCDCPNCQELERLGAAAAGLRKKPIHSCHIPGCGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELERHVRTHTREKKFTCLLCSKRFTRSDHLSKHQRTHGEPGPGPPPSGPKELGEGRSVGEEEANQPPRSSTSPAPPEKAHGGSPEQSNLLEI", "length": 428, "header": "sp|Q8VI67-1|SP7_MOUSE Isoform 1 of Transcription factor Sp7 OS=Mus musculus OX=10090 GN=Sp7 PE=1 SV=1 CANONICAL=Q8VI67-1" }, "locus": { "chromosome": "15", "start_pos": 102274669, "end_pos": 102266575, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000078508", "url": "https://www.ensembl.org/id/ENSMUST00000078508" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000077596", "url": "https://www.ensembl.org/id/ENSMUSP00000077596" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q8VI67", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8VI67" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" } ] } ], "phosphorylation": [ { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8VI67", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8VI67" }, { "database": "PubMed", "id": "20682789", "url": "https://glygen.org/publication/PubMed/20682789" } ], "site_lbl": "Ser73" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8VI67", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8VI67" }, { "database": "PubMed", "id": "20682789", "url": "https://glygen.org/publication/PubMed/20682789" } ], "site_lbl": "Ser77" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "The novel zinc finger-containing transcription factor osterix is required for osteoblast differentiation and bone formation.", "journal": "Cell", "date": "2002", "authors": "Nakashima K, Zhou X, Kunkel G, Zhang Z, Deng JM, Behringer RR, de Crombrugghe B", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "reference": [ { "type": "PubMed", "id": "11792318", "url": "https://glygen.org/publication/PubMed/11792318" } ] }, { "title": "Transcriptional regulation of the osterix (Osx, Sp7) promoter by tumor necrosis factor identifies disparate effects of mitogen-activated protein kinase and NF kappa B pathways.", "journal": "J. Biol. Chem.", "date": "2006", "authors": "He X., Lu X., Gilbert L., Nanes M.S., Rubin J.", "evidence": [ { "database": "UniProtKB", "id": "Q5RM08", "url": "https://www.uniprot.org/uniprot/Q5RM08" } ], "reference": [ { "type": "PubMed", "id": "16410254", "url": "https://glygen.org/publication/PubMed/16410254" } ] }, { "title": "Nuclear factor-E2-related factor-1 mediates ascorbic acid induction of osterix expression via interaction with antioxidant-responsive element in bone cells.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "Kapoor A., Mohan S., Baylink D.J., Xing W., Alarcon C.M., Singgih A.", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "reference": [ { "type": "PubMed", "id": "17510056", "url": "https://glygen.org/publication/PubMed/17510056" } ] }, { "title": "Regulation of the osteoblast-specific transcription factor Osterix by NO66, a Jumonji family histone demethylase.", "journal": "EMBO J.", "date": "2010", "authors": "Sinha KM, Yasuda H, Coombes MM, Dent SY, de Crombrugghe B", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "reference": [ { "type": "PubMed", "id": "19927124", "url": "https://glygen.org/publication/PubMed/19927124" } ] }, { "title": "p38 regulates expression of osteoblast-specific genes by phosphorylation of osterix.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Ortuno MJ, Ruiz-Gaspa S, Rodriguez-Carballo E, Susperregui AR, Bartrons R, Rosa JL, Ventura F", "evidence": [ { "database": "iPTMnet", "id": "Q8VI67", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8VI67" } ], "reference": [ { "type": "PubMed", "id": "20682789", "url": "https://glygen.org/publication/PubMed/20682789" } ] }, { "title": "O-GlcNAcylation is required for B cell homeostasis and antibody responses.", "journal": "Nature communications", "date": "2017", "authors": "Wu JL, Chiang MF, Hsu PH, Tsai DY, Hung KH, Wang YH, Angata T, Lin KI", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q8VI67", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8VI67" } ], "reference": [ { "type": "PubMed", "id": "29187734", "url": "https://glygen.org/publication/PubMed/29187734" } ] }, { "title": "SIRT7 has a critical role in bone formation by regulating lysine acylation of SP7/Osterix.", "journal": "Nat. Commun.", "date": "2018", "authors": "Fukuda M, Yoshizawa T, Karim MF, Sobuz SU, Korogi W, Kobayasi D, Okanishi H, Tasaki M, Ono K, Sawa T, Sato Y, Chirifu M, Masuda T, Nakamura T, Tanoue H, Nakashima K, Kobashigawa Y, Morioka H, Bober E, Ohtsuki S, Yamagata Y, Ando Y, Oike Y, Araki N, Takeda S, Mizuta H, Yamagata K", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "reference": [ { "type": "PubMed", "id": "30026585", "url": "https://glygen.org/publication/PubMed/30026585" } ] } ], "pathway": [ { "id": "mmu:170574", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:170574", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q6IMK2-1", "protein_name": "Sp7 transcription factor", "gene_name": "Sp7", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASSLLEEEAHYGSSPLAMLTAACSKFGGSSPLRDSTALGKGGTKKPYTDLSAPKTMGDAYPAPFSSTNGLLSPAGSPPAPASGYANDYPPFPHSFPGPTGAQDPGLLVPKGHSSSDCLPSVYTSLDMSHPYGSWYKAGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQGTLSTGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSGQLEGSGAGKPPRGAGTGGSGGYAGSGAGRSTCDCPNCQELERLGAAAAGLRKKPIHSCHIPGCGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELERHVRTHTREKKFTCLLCSKRFTRSDHLSKHQRTHGEPGPGPPPSGPKELGEGRSVGEEEANQPPRSSTSPAPPEKAPGGSPEQSNLLEI", "length": 428 }, "evidence": [ { "id": "45226286", "url": "http://www.informatics.jax.org/homology/45226286", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8TDD2-1", "protein_name": "Transcription factor Sp7", "gene_name": "SP7", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSVGSDLSASKTMGDAYPAPFTSTNGLLSPAGSPPAPTSGYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQGTLPTGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSGQLEGSGGAKPPRGASTGGSGGYGGSGAGRSSCDCPNCQELERLGAAAAGLRKKPIHSCHIPGCGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELERHVRTHTREKKFTCLLCSKRFTRSDHLSKHQRTHGEPGPGPPPSGPKELGEGRSTGEEEASQTPRPSASPATPEKAPGGSPEQSNLLEI", "length": 431 }, "evidence": [ { "id": "45226286", "url": "http://www.informatics.jax.org/homology/45226286", "database": "MGI" }, { "id": "Q8VI67", "url": "https://omabrowser.org/oma/group/Q8VI67/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 12, "go_terms": [ { "name": "diphosphate metabolic process", "id": "GO:0071344", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071344", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" }, { "name": "response to organic cyclic compound", "id": "GO:0014070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014070", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" }, { "name": "hematopoietic stem cell differentiation", "id": "GO:0060218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060218", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" }, { "name": "response to insulin", "id": "GO:0032868", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032868", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" }, { "name": "osteoblast differentiation", "id": "GO:0001649", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001649", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" }, { "name": "cementum mineralization", "id": "GO:0071529", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071529", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" }, { "name": "positive regulation of stem cell differentiation", "id": "GO:2000738", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000738", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" }, { "name": "cellular response to zinc ion starvation", "id": "GO:0034224", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034224", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" }, { "name": "gene expression", "id": "GO:0010467", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010467", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" }, { "name": "regulation of hydrolase activity", "id": "GO:0051336", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051336", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" }, { "name": "DEAD/H-box RNA helicase binding", "id": "GO:0017151", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017151", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Propionylated (PubMed:30026585). Depropionylation at Lys-368 by SIRT7 activates transcription factor activity and positively regulates bone formation by osteoblasts (PubMed:30026585).", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" }, { "database": "PubMed", "id": "30026585", "url": "https://glygen.org/publication/PubMed/30026585" } ] }, { "annotation": "Ubiquitination at leads to proteasomal degradation. SP7 is a short-live protein with an endogenous half-life of approximately 12 hours (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q8VI67", "url": "https://www.uniprot.org/uniprot/Q8VI67" }, { "database": "PubMed", "id": "Q8TDD2", "url": "https://glygen.org/publication/PubMed/Q8TDD2" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }