{ "uniprot_canonical_ac": "Q8VHX0-1", "uniprot_ac": "Q8VHX0", "uniprot_id": "CCG3_RAT", "mass": { "chemical_mass": 35516.0, "monoisotopic_mass": 35516.0 }, "refseq": { "ac": "NP_542422", "name": "voltage-dependent calcium channel gamma-3 subunit", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_542422" }, "gene_names": [ { "name": "Cacng3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8VHX0", "id": "Q8VHX0" }, { "name": "Cacng3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_542422", "id": "NP_542422" } ], "protein_names": [ { "name": "Voltage-dependent calcium channel gamma-3 subunit", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8VHX0" }, { "name": "Neuronal voltage-gated calcium channel gamma-3 subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8VHX0" }, { "name": "TARP gamma-3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8VHX0" }, { "name": "Transmembrane AMPAR regulatory protein gamma-3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8VHX0" }, { "name": "neuronal voltage-gated calcium channel gamma-3 subunit; calcium channel, voltage-dependent, gamma subunit 3; TARP gamma-3; transmembrane AMPAR regulatory protein gamma-3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_542422", "id": "NP_542422" }, { "name": "voltage-dependent calcium channel gamma-3 subunit", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_542422", "id": "NP_542422" } ], "function": [ { "annotation": "Regulates the trafficking to the somatodendritic compartment and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization. Does not show subunit-specific AMPA receptor regulation and regulates all AMPAR subunits. Thought to stabilize the calcium channel in an inactivated (closed) state.", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0#function" }, { "database": "PubMed", "id": "17880894", "url": "https://glygen.org/publication/PubMed/17880894" }, { "database": "PubMed", "id": "19234459", "url": "https://glygen.org/publication/PubMed/19234459" } ] } ], "disease": [ { "disease_id": "DOID:1825", "recommended_name": { "id": "DOID:1825", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1825", "name": "childhood absence epilepsy", "description": "A childhood electroclinical syndrome that is characterized by brief and frequent absence seizures in children with age of onset between four and ten years." }, "synonyms": [ { "id": "DOID:1825", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1825", "name": "petit mal seizure", "description": "" }, { "id": "DOID:1825", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1825", "name": "pyknolepsy", "description": "" } ], "evidence": [ { "id": "1825", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1825" } ] }, { "disease_id": "DOID:4448", "recommended_name": { "id": "DOID:4448", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4448", "name": "macular degeneration", "description": "A retinal degeneration characterized by gradual deterioration of light-sensing cells in the tissues at the back of the eye and has_symptom vision loss." }, "synonyms": [ { "id": "DOID:4448", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4448", "name": "Macular degeneration of retina", "description": "" } ], "evidence": [ { "id": "4448", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:4448" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "common_name": "Rat" } ], "gene": [ { "name": "Cacng3", "url": "https://www.uniprot.org/uniprot/Q8VHX0", "locus": { "chromosome": "1", "start_pos": 177297024, "end_pos": 177201288, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000012362", "url": "https://www.ensembl.org/id/ENSRNOG00000012362" } ] } } ], "crossref": [ { "id": "ENSRNOG00000012362", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000012362", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "140724", "url": "https://www.ncbi.nlm.nih.gov/gene/140724", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR004031", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004031", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008368", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008368", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:140724", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:140724", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "QIHNSIP", "url": "https://omabrowser.org/oma/group/QIHNSIP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2957055at2759", "url": "http://www.orthodb.org/?query=2957055at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12107", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12107", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12107:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12107:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "7TNJ", "url": "https://www.rcsb.org/structure/7TNJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TNK", "url": "https://www.rcsb.org/structure/7TNK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TNL", "url": "https://www.rcsb.org/structure/7TNL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TNM", "url": "https://www.rcsb.org/structure/7TNM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TNP", "url": "https://www.rcsb.org/structure/7TNP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00822", "url": "http://pfam.xfam.org/family/PF00822", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8VHX0", "url": "http://purl.obolibrary.org/obo/PR_Q8VHX0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-399719", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-399719", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5682910", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5682910", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_542422", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_542422", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "628803", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=628803", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8VHX0-1", "url": "https://www.uniprot.org/uniprot/Q8VHX0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTHSGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGLCVAASEFHRSRHSVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRARSHSELLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKLTMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPANRRTTPV", "length": 315, "header": "sp|Q8VHX0-1|CCG3_RAT Isoform 1 of Voltage-dependent calcium channel gamma-3 subunit OS=Rattus norvegicus OX=10116 GN=Cacng3 PE=1 SV=1 CANONICAL=Q8VHX0-1" }, "isoforms": [ { "isoform_ac": "Q8VHX0-1", "url": "", "sequence": { "sequence": "MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTHSGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGLCVAASEFHRSRHSVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRARSHSELLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKLTMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPANRRTTPV", "length": 315, "header": "sp|Q8VHX0-1|CCG3_RAT Isoform 1 of Voltage-dependent calcium channel gamma-3 subunit OS=Rattus norvegicus OX=10116 GN=Cacng3 PE=1 SV=1 CANONICAL=Q8VHX0-1" }, "locus": { "chromosome": "1", "start_pos": 177296470, "end_pos": 177201990, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000016632", "url": "https://www.ensembl.org/id/ENSRNOT00000016632" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000016632", "url": "https://www.ensembl.org/id/ENSRNOP00000016632" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 248, "end_pos": 248, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "iPTMnet", "id": "Q8VHX0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8VHX0" } ], "site_lbl": "Ser248" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Calcium channel gamma subunits provide insights into the evolution of this gene family.", "journal": "Gene", "date": "2001", "authors": "Chu PJ, Robertson HM, Best PM", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "reference": [ { "type": "PubMed", "id": "11738816", "url": "https://glygen.org/publication/PubMed/11738816" } ] }, { "title": "TARP subtypes differentially and dose-dependently control synaptic AMPA receptor gating.", "journal": "Neuron", "date": "2007", "authors": "Milstein AD, Zhou W, Karimzadegan S, Bredt DS, Nicoll RA", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "reference": [ { "type": "PubMed", "id": "17880894", "url": "https://glygen.org/publication/PubMed/17880894" } ] }, { "title": "Selective regulation of long-form calcium-permeable AMPA receptors by an atypical TARP, gamma-5.", "journal": "Nat. Neurosci.", "date": "2009", "authors": "Soto D, Coombs ID, Renzi M, Zonouzi M, Farrant M, Cull-Candy SG", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "reference": [ { "type": "PubMed", "id": "19234459", "url": "https://glygen.org/publication/PubMed/19234459" } ] }, { "title": "Functional proteomics identify cornichon proteins as auxiliary subunits of AMPA receptors.", "journal": "Science", "date": "2009", "authors": "Schwenk J, Harmel N, Zolles G, Bildl W, Kulik A, Heimrich B, Chisaka O, Jonas P, Schulte U, Fakler B, Klocker N", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "reference": [ { "type": "PubMed", "id": "19265014", "url": "https://glygen.org/publication/PubMed/19265014" } ] }, { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nature communications", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" }, { "database": "iPTMnet", "id": "Q8VHX0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8VHX0" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] } ], "pathway": [ { "id": "rno:140724", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:140724", "resource": "KEGG Pathway" }, { "id": "R-RNO-399719", "name": "Trafficking of AMPA receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-399719", "resource": "Reactome", "description": "Trafficking of AMPA receptors" }, { "id": "R-RNO-5682910", "name": "LGI-ADAM interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5682910", "resource": "Reactome", "description": "LGI-ADAM interactions" } ], "orthologs": [ { "uniprot_canonical_ac": "O60359-1", "protein_name": "Voltage-dependent calcium channel gamma-3 subunit", "gene_name": "CACNG3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTHSGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGLCVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPANRRTTPV", "length": 315 }, "evidence": [ { "id": "45230062", "url": "http://www.informatics.jax.org/homology/45230062", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9JJV5-1", "protein_name": "Voltage-dependent calcium channel gamma-3 subunit", "gene_name": "Cacng3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTHSGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGLCVAASEFHRSRHSVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRARSHSELLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKLTMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPANRRTTPV", "length": 315 }, "evidence": [ { "id": "45230062", "url": "http://www.informatics.jax.org/homology/45230062", "database": "MGI" }, { "id": "Q8VHX0", "url": "https://omabrowser.org/oma/group/Q8VHX0/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "glutamatergic synapse", "id": "GO:0098978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098978", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" }, { "name": "AMPA glutamate receptor complex", "id": "GO:0032281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032281", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" }, { "name": "somatodendritic compartment", "id": "GO:0036477", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036477", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" }, { "name": "excitatory synapse", "id": "GO:0060076", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060076", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" }, { "name": "postsynaptic density membrane", "id": "GO:0098839", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098839", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" }, { "name": "Schaffer collateral - CA1 synapse", "id": "GO:0098685", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098685", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "protein targeting", "id": "GO:0006605", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006605", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" }, { "name": "positive regulation of synaptic transmission, glutamatergic", "id": "GO:0051968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051968", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" }, { "name": "positive regulation of AMPA receptor activity", "id": "GO:2000969", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000969", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" }, { "name": "transmission of nerve impulse", "id": "GO:0019226", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019226", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" }, { "name": "protein localization", "id": "GO:0008104", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008104", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" }, { "name": "neurotransmitter receptor transport, postsynaptic endosome to lysosome", "id": "GO:0098943", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098943", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" }, { "name": "neurotransmitter receptor internalization", "id": "GO:0099590", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099590", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" }, { "name": "regulation of AMPA receptor activity", "id": "GO:2000311", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000311", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" }, { "name": "postsynaptic neurotransmitter receptor diffusion trapping", "id": "GO:0098970", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098970", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" }, { "name": "neurotransmitter receptor localization to postsynaptic specialization membrane", "id": "GO:0099645", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099645", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "PDZ domain binding", "id": "GO:0030165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030165", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" }, { "name": "voltage-gated calcium channel activity", "id": "GO:0005245", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005245", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" }, { "name": "ionotropic glutamate receptor binding", "id": "GO:0035255", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035255", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" }, { "name": "channel regulator activity", "id": "GO:0016247", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016247", "evidence": [ { "database": "UniProtKB", "id": "Q8VHX0", "url": "https://www.uniprot.org/uniprot/Q8VHX0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 293, "end_pos": 295, "annotation": "n_glycosylation_sequon" }, { "start_pos": 48, "end_pos": 50, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }