{
    "uniprot_canonical_ac": "Q8VHL0-1",
    "uniprot_ac": "Q8VHL0",
    "uniprot_id": "UT1_MOUSE",
    "mass": {
        "chemical_mass": 42126.0,
        "monoisotopic_mass": 42126.0
    },
    "refseq": {
        "ac": "NP_001164481",
        "name": "urea transporter 1 isoform a",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001164481"
    },
    "gene_names": [
        {
            "name": "Slc14a1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q8VHL0",
            "id": "Q8VHL0"
        },
        {
            "name": "2610507K20Rik; 3021401A05Rik; UT-B; Utb1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001164481",
            "id": "NP_001164481"
        },
        {
            "name": "Slc14a1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001164481",
            "id": "NP_001164481"
        }
    ],
    "protein_names": [
        {
            "name": "Urea transporter 1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q8VHL0"
        },
        {
            "name": "Solute carrier family 14 member 1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8VHL0"
        },
        {
            "name": "UT-B",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8VHL0"
        },
        {
            "name": "Urea transporter B",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8VHL0"
        },
        {
            "name": "Urea transporter, erythrocyte",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8VHL0"
        },
        {
            "name": "urea transporter 1 isoform a",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001164481",
            "id": "NP_001164481"
        },
        {
            "name": "urea transporter 1; urea transporter B; urea transporter, erythrocyte; solute carrier family 14 member 1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001164481",
            "id": "NP_001164481"
        }
    ],
    "function": [
        {
            "annotation": "Inhibition of Urea Transporter (UT)-B Modulates LPS-Induced Inflammatory Responses in BV2 Microglia and N2a Neuroblastoma Cells.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001164481",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001164481"
                },
                {
                    "database": "PubMed",
                    "id": "33675462",
                    "url": "https://glygen.org/publication/PubMed/33675462"
                }
            ]
        },
        {
            "annotation": "Mediates the transport of urea driven by a concentration gradient across the cell membranes of erythrocytes and the renal inner medullary collecting duct which is critical to the urinary concentrating mechanism (PubMed:11792714). Facilitates water transport in erythrocytes (PubMed:12133842).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8VHL0",
                    "url": "https://www.uniprot.org/uniprot/Q8VHL0#function"
                },
                {
                    "database": "PubMed",
                    "id": "12133842",
                    "url": "https://glygen.org/publication/PubMed/12133842"
                },
                {
                    "database": "PubMed",
                    "id": "11792714",
                    "url": "https://glygen.org/publication/PubMed/11792714"
                }
            ]
        },
        {
            "annotation": "Potassium depletion is associated with reduced expression of UT-A1, UT-A3, and UT-B but increased expression of UT-A2",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001164481",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001164481"
                },
                {
                    "database": "PubMed",
                    "id": "12952854",
                    "url": "https://glygen.org/publication/PubMed/12952854"
                }
            ]
        },
        {
            "annotation": "Results suggest that the depletion of SLC14alpha1 gene in mice may contribute to the HS-induced abnormality of sodium transportation in the CSF",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001164481",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001164481"
                },
                {
                    "database": "PubMed",
                    "id": "32387413",
                    "url": "https://glygen.org/publication/PubMed/32387413"
                }
            ]
        },
        {
            "annotation": "UT-B has a role in urinary concentrating ability in mice",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001164481",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001164481"
                },
                {
                    "database": "PubMed",
                    "id": "12133842",
                    "url": "https://glygen.org/publication/PubMed/12133842"
                }
            ]
        },
        {
            "annotation": "UT-B-deficient mice reveal that countercurrent exchange of urea in renal medullary vessels and red blood cells accounts for a major part of the kidney's concentrating ability and for the adaptation of renal urea handling during a high-protein intake.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001164481",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001164481"
                },
                {
                    "database": "PubMed",
                    "id": "12965892",
                    "url": "https://glygen.org/publication/PubMed/12965892"
                }
            ]
        },
        {
            "annotation": "Water transport mediated by murine urea transporters: implications for urine concentration mechanisms. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001164481",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001164481"
                },
                {
                    "database": "PubMed",
                    "id": "32661130",
                    "url": "https://glygen.org/publication/PubMed/32661130"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8VHL0",
                    "url": "https://www.uniprot.org/uniprot/Q8VHL0"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Slc14a1",
            "url": "https://www.uniprot.org/uniprot/Q8VHL0",
            "locus": {
                "chromosome": "18",
                "start_pos": 78143306,
                "end_pos": 78185334,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000059336",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000059336"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000059336",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000059336",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "CHEMBL2163171",
            "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2163171",
            "database": "ChEMBL",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "108052",
            "url": "https://www.ncbi.nlm.nih.gov/gene/108052",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "GPDB0006997",
            "url": "https://acgg.asia/db/gpdb/symbol/GPDB0006997",
            "database": "GlycoProtDB",
            "categories": [
                "Glycoproteomics"
            ]
        },
        {
            "id": "GPDB0006998",
            "url": "https://acgg.asia/db/gpdb/symbol/GPDB0006998",
            "database": "GlycoProtDB",
            "categories": [
                "Glycoproteomics"
            ]
        },
        {
            "id": "IPR004937",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR004937",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR029020",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR029020",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:108052",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:108052",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "1351654",
            "url": "http://www.informatics.jax.org/marker/MGI:1351654",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "3682310at2759",
            "url": "http://www.orthodb.org/?query=3682310at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10464",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10464",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10464:SF5",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10464:SF5",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF03253",
            "url": "http://pfam.xfam.org/family/PF03253",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q8VHL0",
            "url": "http://purl.obolibrary.org/obo/PR_Q8VHL0",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-MMU-425366",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-425366",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_001164481",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001164481",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "32799",
            "url": "https://www.rhea-db.org/rhea/32799",
            "database": "Rhea",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "Q8VHL0",
            "url": "https://www.uniprot.org/uniprot/Q8VHL0",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8VHL0-1",
            "url": "https://www.uniprot.org/uniprot/Q8VHL0-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8VHL0-2",
            "url": "https://www.uniprot.org/uniprot/Q8VHL0-2",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MEDSPTMVKVDRGENQILSCRGRRCGFKVLGYVTGDMKEFANWLKDKPVVLQFMDWILRGISQVVFVSNPISGILILVGLLVQNPWWALCGCVGTVVSTLTALLLSQDRSAIAAGLQGYNATLVGILMAVFSNKGDYFWWLIFPVSAMSMTCPVFSSALSSVLSKWDLPVFTLPFNMALSMYLSATGHYNTFFPSKLFTPVSSVPNITWSELSALELLKSLPVGVGQIYGCDNPWTGGIFLCAILLSSPLMCLHAAIGSLLGVIAGLSLAAPFEDIYFGLWGFNSSLACIAIGGMFMALTWQTHLLALACALFTAYFGACMAHLMAVVHLPACTWSFCLATLLFLLLTTKNPNIYRMPLSKVTYSEENRIFYLQNKKRMVESPL",
        "length": 384,
        "header": "sp|Q8VHL0-1|UT1_MOUSE Isoform 1 of Urea transporter 1  OS=Mus musculus OX=10090 GN=Slc14a1 PE=1 SV=2 CANONICAL=Q8VHL0-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q8VHL0-1",
            "url": "",
            "sequence": {
                "sequence": "MEDSPTMVKVDRGENQILSCRGRRCGFKVLGYVTGDMKEFANWLKDKPVVLQFMDWILRGISQVVFVSNPISGILILVGLLVQNPWWALCGCVGTVVSTLTALLLSQDRSAIAAGLQGYNATLVGILMAVFSNKGDYFWWLIFPVSAMSMTCPVFSSALSSVLSKWDLPVFTLPFNMALSMYLSATGHYNTFFPSKLFTPVSSVPNITWSELSALELLKSLPVGVGQIYGCDNPWTGGIFLCAILLSSPLMCLHAAIGSLLGVIAGLSLAAPFEDIYFGLWGFNSSLACIAIGGMFMALTWQTHLLALACALFTAYFGACMAHLMAVVHLPACTWSFCLATLLFLLLTTKNPNIYRMPLSKVTYSEENRIFYLQNKKRMVESPL",
                "length": 384,
                "header": "sp|Q8VHL0-1|UT1_MOUSE Isoform 1 of Urea transporter 1  OS=Mus musculus OX=10090 GN=Slc14a1 PE=1 SV=2 CANONICAL=Q8VHL0-1"
            },
            "locus": {
                "chromosome": "18",
                "start_pos": 78159723,
                "end_pos": 78145613,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000160639",
                        "url": "https://www.ensembl.org/id/ENSMUST00000160639"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000125367",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000125367"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q8VHL0-2",
            "url": "",
            "sequence": {
                "sequence": "MNGQSLTGGTDDAHHGPLWIDPFGNRGDKAAPEGFRRLSLALAQRWREQEPEEEIAMEDSPTMVKVDRGENQILSCRGRRCGFKVLGYVTGDMKEFANWLKDKPVVLQFMDWILRGISQVVFVSNPISGILILVGLLVQNPWWALCGCVGTVVSTLTALLLSQDRSAIAAGLQGYNATLVGILMAVFSNKGDYFWWLIFPVSAMSMTCPVFSSALSSVLSKWDLPVFTLPFNMALSMYLSATGHYNTFFPSKLFTPVSSVPNITWSELSALELLKSLPVGVGQIYGCDNPWTGGIFLCAILLSSPLMCLHAAIGSLLGVIAGLSLAAPFEDIYFGLWGFNSSLACIAIGGMFMALTWQTHLLALACALFTAYFGACMAHLMAVVHLPACTWSFCLATLLFLLLTTKNPNIYRMPLSKVTYSEENRIFYLQNKKRMVESPL",
                "length": 440,
                "header": "sp|Q8VHL0-2|UT1_MOUSE Isoform 2 of Urea transporter 1  OS=Mus musculus OX=10090 GN=Slc14a1 PE=1 SV=2 CANONICAL=Q8VHL0-1"
            },
            "locus": {
                "chromosome": "18",
                "start_pos": 78163509,
                "end_pos": 78145613,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000160292",
                        "url": "https://www.ensembl.org/id/ENSMUST00000160292"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000125114",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000125114"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 206,
            "start_aa": "Asn",
            "end_pos": 206,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn206",
            "evidence": [
                {
                    "id": "Q8VHL0",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q8VHL0#ptm_processing"
                }
            ]
        }
    ],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "glycoprotein",
        "glycoprotein_predicted"
    ],
    "publication": [
        {
            "title": "Urea-selective concentrating defect in transgenic mice lacking urea transporter UT-B.",
            "journal": "J. Biol. Chem.",
            "date": "2002",
            "authors": "Yang B, Bankir L, Gillespie A, Epstein CJ, Verkman AS",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8VHL0",
                    "url": "https://www.uniprot.org/uniprot/Q8VHL0"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11792714",
                    "url": "https://glygen.org/publication/PubMed/11792714"
                }
            ]
        },
        {
            "title": "Analysis of double knockout mice lacking aquaporin-1 and urea transporter UT-B. Evidence for UT-B-facilitated water transport in erythrocytes.",
            "journal": "J. Biol. Chem.",
            "date": "2002",
            "authors": "Yang B, Verkman AS",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8VHL0",
                    "url": "https://www.uniprot.org/uniprot/Q8VHL0"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_001164481",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001164481"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12133842",
                    "url": "https://glygen.org/publication/PubMed/12133842"
                }
            ]
        },
        {
            "title": "Expression of urea transporters in potassium-depleted mouse kidney.",
            "journal": "American journal of physiology. Renal physiology",
            "date": "2003",
            "authors": "Jung JY, Madsen KM, Han KH, Yang CW, Knepper MA, Sands JM, Kim J",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001164481",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001164481"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12952854",
                    "url": "https://glygen.org/publication/PubMed/12952854"
                }
            ]
        },
        {
            "title": "Lack of UT-B in vasa recta and red blood cells prevents urea-induced improvement of urinary concentrating ability.",
            "journal": "American journal of physiology. Renal physiology",
            "date": "2004",
            "authors": "Bankir L, Chen K, Yang B",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001164481",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001164481"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12965892",
                    "url": "https://glygen.org/publication/PubMed/12965892"
                }
            ]
        },
        {
            "title": "UT-B1 urea transporter is expressed along the urinary and gastrointestinal tracts of the mouse.",
            "journal": "Am. J. Physiol.",
            "date": "2005",
            "authors": "Lucien N, Bruneval P, Lasbennes F, Belair MF, Mandet C, Cartron J, Bailly P, Trinh-Trang-Tan MM",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8VHL0",
                    "url": "https://www.uniprot.org/uniprot/Q8VHL0"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15563580",
                    "url": "https://glygen.org/publication/PubMed/15563580"
                }
            ]
        },
        {
            "title": "High salt diet elevates the mean arterial pressure of SLC14alpha1 gene depletion mice.",
            "journal": "Life sciences",
            "date": "2020",
            "authors": "Wang S, Liu J, Cai H, Liu K, He Y, Liu S, Guo Y, Guo L",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001164481",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001164481"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "32387413",
                    "url": "https://glygen.org/publication/PubMed/32387413"
                }
            ]
        },
        {
            "title": "Water transport mediated by murine urea transporters: implications for urine concentration mechanisms.",
            "journal": "Biology open",
            "date": "2020",
            "authors": "Kabutomori J, Pina-Lopes N, Musa-Aziz R",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001164481",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001164481"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "32661130",
                    "url": "https://glygen.org/publication/PubMed/32661130"
                }
            ]
        },
        {
            "title": "Inhibition of Urea Transporter (UT)-B Modulates LPS-Induced Inflammatory Responses in BV2 Microglia and N2a Neuroblastoma Cells.",
            "journal": "Neurochemical research",
            "date": "2021",
            "authors": "Jones AC, Pinki F, Stewart GS, Costello DA",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001164481",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001164481"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "33675462",
                    "url": "https://glygen.org/publication/PubMed/33675462"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:108052",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:108052",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-MMU-425366",
            "name": "Transport of bile salts and organic acids, metal ions and amine compounds",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-425366",
            "resource": "Reactome",
            "description": "Transport of bile salts and organic acids, metal ions and amine compounds"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "P97689-1",
            "protein_name": "Urea transporter 1",
            "gene_name": "Slc14a1",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MEDIPTMVKVDRGESQILSCRGRRCGLKVLGYVTGDMKEFANWLKDKPVVLQFMDWILRGISQVVFVSNPISGILILAGLLVQNPWWALCGCVGTVVSTLTALLLSQDRSAIAAGLQGYNATLVGILMAVFSDKGDYFWWLIFPVSAMSMTCPVFSSALSSLFSKWDLPVFTLPFNMALSLYLSATGHYNTFFPSKLFMPVSSVPNITWSELSALELLKSLPVGVGQIYGCDNPWTGAIFLCAILLSSPLMCLHAAIGSLLGVIAGLSLAAPFKDIYSGLWGFNSSLACIAIGGMFMALTWQTHLLALACALFTAYFGACMTHLMAAVHLPACTWSFCLATLLFLLLTTENPNIYRMPLSKVTYSEENRIFYLQNKKRVVDSPL",
                "length": 384
            },
            "evidence": [
                {
                    "id": "45235795",
                    "url": "http://www.informatics.jax.org/homology/45235795",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        },
        {
            "uniprot_canonical_ac": "Q13336-1",
            "protein_name": "Urea transporter 1",
            "gene_name": "SLC14A1",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MEDSPTMVRVDSPTMVRGENQVSPCQGRRCFPKALGYVTGDMKELANQLKDKPVVLQFIDWILRGISQVVFVNNPVSGILILVGLLVQNPWWALTGWLGTVVSTLMALLLSQDRSLIASGLYGYNATLVGVLMAVFSDKGDYFWWLLLPVCAMSMTCPIFSSALNSMLSKWDLPVFTLPFNMALSMYLSATGHYNPFFPAKLVIPITTAPNISWSDLSALELLKSIPVGVGQIYGCDNPWTGGIFLGAILLSSPLMCLHAAIGSLLGIAAGLSLSAPFEDIYFGLWGFNSSLACIAMGGMFMALTWQTHLLALGCALFTAYLGVGMANFMAEVGLPACTWPFCLATLLFLIMTTKNSNIYKMPLSKVTYPEENRIFYLQAKKRMVESPL",
                "length": 389
            },
            "evidence": [
                {
                    "id": "45235795",
                    "url": "http://www.informatics.jax.org/homology/45235795",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 4,
                "go_terms": [
                    {
                        "name": "urea transmembrane transport",
                        "id": "GO:0071918",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071918",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VHL0",
                                "url": "https://www.uniprot.org/uniprot/Q8VHL0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "water transport",
                        "id": "GO:0006833",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006833",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VHL0",
                                "url": "https://www.uniprot.org/uniprot/Q8VHL0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "urea transport",
                        "id": "GO:0015840",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015840",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VHL0",
                                "url": "https://www.uniprot.org/uniprot/Q8VHL0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "establishment of localization in cell",
                        "id": "GO:0051649",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051649",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VHL0",
                                "url": "https://www.uniprot.org/uniprot/Q8VHL0"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 3,
                "go_terms": [
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VHL0",
                                "url": "https://www.uniprot.org/uniprot/Q8VHL0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "membrane",
                        "id": "GO:0016020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VHL0",
                                "url": "https://www.uniprot.org/uniprot/Q8VHL0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "basolateral plasma membrane",
                        "id": "GO:0016323",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016323",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VHL0",
                                "url": "https://www.uniprot.org/uniprot/Q8VHL0"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 3,
                "go_terms": [
                    {
                        "name": "water transmembrane transporter activity",
                        "id": "GO:0005372",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005372",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VHL0",
                                "url": "https://www.uniprot.org/uniprot/Q8VHL0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "urea channel activity",
                        "id": "GO:0015265",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015265",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VHL0",
                                "url": "https://www.uniprot.org/uniprot/Q8VHL0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "urea transmembrane transporter activity",
                        "id": "GO:0015204",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015204",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VHL0",
                                "url": "https://www.uniprot.org/uniprot/Q8VHL0"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 120,
            "end_pos": 122,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 206,
            "end_pos": 208,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 284,
            "end_pos": 286,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [
        {
            "annotation": "N-glycosylated in red blood cells, as well as in most non-erythroid tissues, except in the gastrocnemius muscle and in the gastrointestinal tract, including liver, colon and stomach.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8VHL0",
                    "url": "https://www.uniprot.org/uniprot/Q8VHL0"
                },
                {
                    "database": "PubMed",
                    "id": "15563580",
                    "url": "https://glygen.org/publication/PubMed/15563580"
                }
            ]
        }
    ],
    "interactions": [],
    "reactions": [
        {
            "id": "32799",
            "name": "",
            "equation": "urea(in) = urea(out)",
            "summary": "",
            "cellular_location": "",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [],
            "evidence": [
                {
                    "id": "32799",
                    "database": "Rhea",
                    "url": "https://www.rhea-db.org/rhea/32799"
                }
            ]
        }
    ],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 1
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 1
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 8
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}