{
    "uniprot_canonical_ac": "Q8VGI6-1",
    "uniprot_ac": "Q8VGI6",
    "uniprot_id": "O5P56_MOUSE",
    "mass": {
        "chemical_mass": 34141.0,
        "monoisotopic_mass": 34141.0
    },
    "refseq": {
        "ac": "NP_667137",
        "name": "olfactory receptor 5P56",
        "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667137"
    },
    "gene_names": [
        {
            "name": "Or5p56",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q8VGI6",
            "id": "Q8VGI6"
        },
        {
            "name": "MOR204-1; Olfr477",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667137",
            "id": "NP_667137"
        },
        {
            "name": "Mor204-1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q8VGI6",
            "id": "Q8VGI6"
        },
        {
            "name": "Olfr477",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q8VGI6",
            "id": "Q8VGI6"
        },
        {
            "name": "Or5p56",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667137",
            "id": "NP_667137"
        }
    ],
    "protein_names": [
        {
            "name": "Olfactory receptor 5P56",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q8VGI6"
        },
        {
            "name": "Olfactory receptor 204-1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8VGI6"
        },
        {
            "name": "Olfactory receptor 477",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8VGI6"
        },
        {
            "name": "olfactory receptor 5P56",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667137",
            "id": "NP_667137"
        },
        {
            "name": "olfactory receptor MOR204-1; olfactory receptor 204-1; GA_x6K02T2PBJ9-10319672-10320604; olfactory receptor 477",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667137",
            "id": "NP_667137"
        }
    ],
    "function": [
        {
            "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_667137",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667137"
                }
            ]
        },
        {
            "annotation": "Potential odorant receptor.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8VGI6",
                    "url": "https://www.uniprot.org/uniprot/Q8VGI6#function"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8VGI6",
                    "url": "https://www.uniprot.org/uniprot/Q8VGI6"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Or5p56",
            "url": "https://www.uniprot.org/uniprot/Q8VGI6",
            "locus": {
                "chromosome": "7",
                "start_pos": 107591930,
                "end_pos": 107585900,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000096151",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000096151"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "258928",
            "url": "https://www.ncbi.nlm.nih.gov/gene/258928",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR000276",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR000725",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017452",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:258928",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:258928",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "3030311",
            "url": "http://www.informatics.jax.org/marker/MGI:3030311",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "PRICMFL",
            "url": "https://omabrowser.org/oma/group/PRICMFL/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5401587at2759",
            "url": "http://www.orthodb.org/?query=5401587at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR48018",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR48018:SF193",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018:SF193",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF13853",
            "url": "http://pfam.xfam.org/family/PF13853",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q8VGI6",
            "url": "http://purl.obolibrary.org/obo/PR_Q8VGI6",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_667137",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667137",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8VGI6",
            "url": "https://www.uniprot.org/uniprot/Q8VGI6",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8VGI6-1",
            "url": "https://www.uniprot.org/uniprot/Q8VGI6-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MEAQNHTTVKEFILLGLTENSTLRVILFMIFLGIYTVTLVGNFSIISLIRSCPQLHTPMYLFLSHLALVDIGFSTSITPIMLTGFLGHTVTLSVAACVAQFCIAVTFGTVECFLLAVMAYDRYVAICSPLLYSTHMSPRICFLLVGASYVGGCVNSGTFTSCLLILSFCGPNQIDHFFCDFPAVLKLSCSDVSIIGIIPSISAGSIIVITVFVIAVSYTYILITILNMRSTEGRHKAFSTCTSHLTAVTLYYGTITFIYVMPKSNYSTAQNKILSVFYTVVIPMLNPLIYSLRNRDVKEALRKAIIRIFP",
        "length": 310,
        "header": "sp|Q8VGI6-1|O5P56_MOUSE Isoform 1 of Olfactory receptor 5P56  OS=Mus musculus OX=10090 GN=Or5p56 PE=3 SV=1 CANONICAL=Q8VGI6-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q8VGI6-1",
            "url": "",
            "sequence": {
                "sequence": "MEAQNHTTVKEFILLGLTENSTLRVILFMIFLGIYTVTLVGNFSIISLIRSCPQLHTPMYLFLSHLALVDIGFSTSITPIMLTGFLGHTVTLSVAACVAQFCIAVTFGTVECFLLAVMAYDRYVAICSPLLYSTHMSPRICFLLVGASYVGGCVNSGTFTSCLLILSFCGPNQIDHFFCDFPAVLKLSCSDVSIIGIIPSISAGSIIVITVFVIAVSYTYILITILNMRSTEGRHKAFSTCTSHLTAVTLYYGTITFIYVMPKSNYSTAQNKILSVFYTVVIPMLNPLIYSLRNRDVKEALRKAIIRIFP",
                "length": 310,
                "header": "sp|Q8VGI6-1|O5P56_MOUSE Isoform 1 of Olfactory receptor 5P56  OS=Mus musculus OX=10090 GN=Or5p56 PE=3 SV=1 CANONICAL=Q8VGI6-1"
            },
            "locus": {
                "chromosome": "7",
                "start_pos": 107590503,
                "end_pos": 107589574,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000214677",
                        "url": "https://www.ensembl.org/id/ENSMUST00000214677"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000150605",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000150605"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 20,
            "start_aa": "Asn",
            "end_pos": 20,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn20",
            "evidence": [
                {
                    "id": "Q8VGI6",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q8VGI6#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 265,
            "start_aa": "Asn",
            "end_pos": 265,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn265",
            "evidence": [
                {
                    "id": "Q8VGI6",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q8VGI6#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 5,
            "start_aa": "Asn",
            "end_pos": 5,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn5",
            "evidence": [
                {
                    "id": "Q8VGI6",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q8VGI6#ptm_processing"
                }
            ]
        }
    ],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "glycoprotein",
        "glycoprotein_predicted"
    ],
    "publication": [],
    "pathway": [
        {
            "id": "mmu:258928",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:258928",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "D3ZST0-1",
            "protein_name": "Olfactory receptor",
            "gene_name": "Or5p56",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MEAQNHTTVTEFILLGLTENSTLRVILFMTFLGIYAVTVVGNFSIISLIRNCPQLHTPMYLFLSHLAFVDIGFSTSITPIMLTGFLERTITLSVAACEAQFCIAVTFGTVECFLLAAMAYDRYVAICSPLLYSTHMSPRICFLLVGASYVGGCVNSWTFTSCLLSLSFCGPNQIDHFFCDFPAVLKLSCSDVSIIGMIPSISAGTIIVVTVFVIAVSYTYILITILKMRSTEGRKKAFSTCTSHLTAVTLYYGTITFIYVMPKSNYSTEQNKILSVFYTVVIPMLNPLIYSLRNRDVKEALRKAIIRIFP",
                "length": 310
            },
            "evidence": [
                {
                    "id": "45245426",
                    "url": "http://www.informatics.jax.org/homology/45245426",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 3,
                "go_terms": [
                    {
                        "name": "G protein-coupled receptor activity",
                        "id": "GO:0004930",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VGI6",
                                "url": "https://www.uniprot.org/uniprot/Q8VGI6"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "olfactory receptor activity",
                        "id": "GO:0004984",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VGI6",
                                "url": "https://www.uniprot.org/uniprot/Q8VGI6"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "odorant binding",
                        "id": "GO:0005549",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005549",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VGI6",
                                "url": "https://www.uniprot.org/uniprot/Q8VGI6"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VGI6",
                                "url": "https://www.uniprot.org/uniprot/Q8VGI6"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "membrane",
                        "id": "GO:0016020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VGI6",
                                "url": "https://www.uniprot.org/uniprot/Q8VGI6"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 2,
                "go_terms": [
                    {
                        "name": "G protein-coupled receptor signaling pathway",
                        "id": "GO:0007186",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VGI6",
                                "url": "https://www.uniprot.org/uniprot/Q8VGI6"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "sensory perception of smell",
                        "id": "GO:0007608",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007608",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VGI6",
                                "url": "https://www.uniprot.org/uniprot/Q8VGI6"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 20,
            "end_pos": 22,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 265,
            "end_pos": 267,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 42,
            "end_pos": 44,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 5,
            "end_pos": 7,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 3
                },
                {
                    "field": "total_sites",
                    "count": 3
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 3
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 3
                },
                {
                    "field": "total_sites",
                    "count": 3
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 3
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        }
    ]
}