{ "uniprot_canonical_ac": "Q8VEK0-1", "uniprot_ac": "Q8VEK0", "uniprot_id": "CC50A_MOUSE", "mass": { "chemical_mass": 41061.0, "monoisotopic_mass": 41061.0 }, "refseq": { "ac": "NP_598479", "name": "cell cycle control protein 50A", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598479" }, "gene_names": [ { "name": "Tmem30a", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8VEK0", "id": "Q8VEK0" }, { "name": "2010200I23Rik; Cdc50a; D9Wsu20e", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598479", "id": "NP_598479" }, { "name": "Cdc50a", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q8VEK0", "id": "Q8VEK0" }, { "name": "D9Wsu20e", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q8VEK0", "id": "Q8VEK0" }, { "name": "Tmem30a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598479", "id": "NP_598479" } ], "protein_names": [ { "name": "Cell cycle control protein 50A", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8VEK0" }, { "name": "P4-ATPase flippase complex beta subunit TMEM30A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598479", "id": "NP_598479" }, { "name": "P4-ATPase flippase complex beta subunit TMEM30A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8VEK0" }, { "name": "Transmembrane protein 30A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8VEK0" }, { "name": "cell cycle control protein 50A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598479", "id": "NP_598479" } ], "function": [ { "annotation": "Accessory component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes and ensures the maintenance of asymmetric distribution of phospholipids. Phospholipid translocation seems also to be implicated in vesicle formation and in uptake of lipid signaling molecules. The beta subunit may assist in binding of the phospholipid substrate. Required for the proper folding, assembly and ER to Golgi exit of the ATP8A2:TMEM30A flippase complex. ATP8A2:TMEM30A may be involved in regulation of neurite outgrowth, and, reconstituted to liposomes, predomiminantly transports phosphatidylserine (PS) and to a lesser extent phosphatidylethanolamine (PE). The ATP8A1:TMEM30A flippase complex seems to play a role in regulation of cell migration probably involving flippase-mediated translocation of phosphatidylethanolamine (PE) at the plasma membrane. Required for the formation of the ATP8A2, ATP8B1 and ATP8B2 P-type ATPAse intermediate phosphoenzymes. Involved in uptake of platelet-activating factor (PAF). Can also mediate the export of alpha subunits ATP8A1, ATP8B1, ATP8B2, ATP8B4, ATP10A, ATP10B, ATP10D, ATP11A, ATP11B and ATP11C from the ER to other membrane localizations.", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0#function" }, { "database": "PubMed", "id": "22641037", "url": "https://glygen.org/publication/PubMed/22641037" }, { "database": "PubMed", "id": "23269685", "url": "https://glygen.org/publication/PubMed/23269685" }, { "database": "PubMed", "id": "30018401", "url": "https://glygen.org/publication/PubMed/30018401" }, { "database": "PubMed", "id": "29799007", "url": "https://glygen.org/publication/PubMed/29799007" } ] }, { "annotation": "CDC50A is present as a fully glycosylated protein in vivo, which presumes interaction with distinct P4 ATPases.", "evidence": [ { "database": "RefSeq", "id": "NP_598479", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598479" }, { "database": "PubMed", "id": "22253360", "url": "https://glygen.org/publication/PubMed/22253360" } ] }, { "annotation": "Knockdown of TMEM30A in renal tubular epithelial cells leads to reduced glucose absorption. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_598479", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598479" }, { "database": "PubMed", "id": "37612668", "url": "https://glygen.org/publication/PubMed/37612668" } ] }, { "annotation": "Phospholipid-flippase chaperone CDC50A is required for synapse maintenance by regulating phosphatidylserine exposure.", "evidence": [ { "database": "RefSeq", "id": "NP_598479", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598479" }, { "database": "PubMed", "id": "34585770", "url": "https://glygen.org/publication/PubMed/34585770" } ] }, { "annotation": "TMEM30A is essential for hair cell polarity maintenance in postnatal mouse cochlea. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_598479", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598479" }, { "database": "PubMed", "id": "36959542", "url": "https://glygen.org/publication/PubMed/36959542" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Tmem30a", "url": "https://www.uniprot.org/uniprot/Q8VEK0", "locus": { "chromosome": "9", "start_pos": 79676225, "end_pos": 79700789, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000032328", "url": "https://www.ensembl.org/id/ENSMUSG00000032328" } ] } } ], "crossref": [ { "id": "ENSMUSG00000032328", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000032328", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "69981", "url": "https://www.ncbi.nlm.nih.gov/gene/69981", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2201", "url": "https://glyconnect.expasy.org/browser/proteins/2201", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "GPDB0002113", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0002113", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0006987", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0006987", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "Q8VEK0", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q8VEK0*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR005045", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005045", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:69981", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:69981", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "106402", "url": "http://www.informatics.jax.org/marker/MGI:106402", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q8VEK0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8VEK0", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "DHKFGKH", "url": "https://omabrowser.org/oma/group/DHKFGKH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "196427at2759", "url": "http://www.orthodb.org/?query=196427at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10926", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10926", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10926:SF17", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10926:SF17", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03381", "url": "http://pfam.xfam.org/family/PF03381", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8VEK0", "url": "http://purl.obolibrary.org/obo/PR_Q8VEK0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_598479", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598479", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "D3YVV1", "url": "https://www.uniprot.org/uniprot/D3YVV1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YVV1-1", "url": "https://www.uniprot.org/uniprot/D3YVV1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8VEK0-1", "url": "https://www.uniprot.org/uniprot/Q8VEK0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAMNYSAKDEVDGGPAGPPGGAAKTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPNVTSCACTINFTLKQSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKECEPYRRNEDRPIAPCGAIANSMFNDTLELYLVANESDPKPIPIPLKKKGIAWWTDKNVKFRNPPGKESLEEKFKDTIKPVNWHKAVYELDPEDESNNGFINEDFIVWMRTAALPTFRKLYRLIERRDDLHPTLPAGQYFLNITYNYPVHSFDGRKRMILSTISWMGGKNPFLGIAYITIGSISFLLGVVLLVINHKYRNSSNTADITI", "length": 364, "header": "sp|Q8VEK0-1|CC50A_MOUSE Isoform 1 of Cell cycle control protein 50A OS=Mus musculus OX=10090 GN=Tmem30a PE=1 SV=1 CANONICAL=Q8VEK0-1" }, "isoforms": [ { "isoform_ac": "D3YVV1-1", "url": "", "sequence": { "sequence": "MAMNYSAKDEVDGGPAGPPGGAAKTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIFIPIGIGIFVTSNNIREIEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKECEPYRRNEDRPIAPCGAIANSMFNDTLELYLVANESDPKPIPIPLKKKGIAWWTDKNVKFRNPPGKESLEEKFKDTIKPVNWHKAVYELDPEDESNNGFINEDFIVWMRTAALPTFRKLYRLIERRDDLHPTLPAGQYFLNITYNYPVHSFDGRKRMILSTISWMGGKNPFLGIAYITIGSISFLLGVVLLVINHKYRNSSNTADITI", "length": 328, "header": "tr|D3YVV1-1|D3YVV1_MOUSE Computationally mapped isoform of Cell cycle control protein OS=Mus musculus OX=10090 GN=Tmem30a PE=1 SV=1 CANONICAL=Q8VEK0-1" }, "locus": { "chromosome": "9", "start_pos": 79700492, "end_pos": 79678571, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000120690.2", "url": "https://www.ensembl.org/id/ENSMUST00000120690.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000114042.2", "url": "https://www.ensembl.org/id/ENSMUSP00000114042.2" } ] } }, { "isoform_ac": "Q8VEK0-1", "url": "", "sequence": { "sequence": "MAMNYSAKDEVDGGPAGPPGGAAKTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPNVTSCACTINFTLKQSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKECEPYRRNEDRPIAPCGAIANSMFNDTLELYLVANESDPKPIPIPLKKKGIAWWTDKNVKFRNPPGKESLEEKFKDTIKPVNWHKAVYELDPEDESNNGFINEDFIVWMRTAALPTFRKLYRLIERRDDLHPTLPAGQYFLNITYNYPVHSFDGRKRMILSTISWMGGKNPFLGIAYITIGSISFLLGVVLLVINHKYRNSSNTADITI", "length": 364, "header": "sp|Q8VEK0-1|CC50A_MOUSE Isoform 1 of Cell cycle control protein 50A OS=Mus musculus OX=10090 GN=Tmem30a PE=1 SV=1 CANONICAL=Q8VEK0-1" }, "locus": { "chromosome": "9", "start_pos": 79700492, "end_pos": 79678571, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000034878", "url": "https://www.ensembl.org/id/ENSMUST00000034878" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000034878", "url": "https://www.ensembl.org/id/ENSMUSP00000034878" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 297, "start_aa": "Asn", "end_pos": 297, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn297", "evidence": [ { "id": "2201", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2201" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 297, "start_aa": "Asn", "end_pos": 297, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn297", "evidence": [ { "id": "2201", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2201" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G14260UH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 297, "start_aa": "Asn", "end_pos": 297, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn297", "evidence": [ { "id": "2201", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2201" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 297, "start_aa": "Asn", "end_pos": 297, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn297", "evidence": [ { "id": "2201", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2201" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 297, "start_aa": "Asn", "end_pos": 297, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn297", "evidence": [ { "id": "2201", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2201" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 297, "start_aa": "Asn", "end_pos": 297, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn297", "evidence": [ { "id": "2201", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2201" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 297, "start_aa": "Asn", "end_pos": 297, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn297", "evidence": [ { "id": "2201", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2201" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 297, "start_aa": "Asn", "end_pos": 297, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn297", "evidence": [ { "id": "2201", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2201" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 297, "start_aa": "Asn", "end_pos": 297, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn297", "evidence": [ { "id": "2201", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2201" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 297, "start_aa": "Asn", "end_pos": 297, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn297", "evidence": [ { "id": "2201", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2201" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 297, "start_aa": "Asn", "end_pos": 297, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn297", "evidence": [ { "id": "Q8VEK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VEK0#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "Q8VEK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VEK0#ptm_processing" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q8VEK0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8VEK0" }, { "id": "33300544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33300544" }, { "id": "22645316", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22645316" } ] } ], "phosphorylation": [ { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q8VEK0", "url": "http://phospho.elm.eu.org/byAccession/Q8VEK0.html" }, { "database": "iPTMnet", "id": "Q8VEK0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8VEK0" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" } ], "site_lbl": "Tyr5" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Large-scale phosphorylation analysis of mouse liver.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2007", "authors": "Villen J, Beausoleil SA, Gerber SA, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" }, { "database": "UniProtKB", "id": "D3YVV1", "url": "https://www.uniprot.org/uniprot/D3YVV1" }, { "database": "iPTMnet", "id": "Q8VEK0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8VEK0" } ], "reference": [ { "type": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" } ] }, { "title": "Cellular localization and biochemical analysis of mammalian CDC50A, a glycosylated beta-subunit for P4 ATPases.", "journal": "J. Histochem. Cytochem.", "date": "2012", "authors": "Folmer DE, Mok KS, de Wee SW, Duijst S, Hiralall JK, Seppen J, Oude Elferink RP, Paulusma CC", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" }, { "database": "RefSeq", "id": "NP_598479", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598479" } ], "reference": [ { "type": "PubMed", "id": "22253360", "url": "https://glygen.org/publication/PubMed/22253360" } ] }, { "title": "Critical role of a transmembrane lysine in aminophospholipid transport by mammalian photoreceptor P4-ATPase ATP8A2.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2012", "authors": "Molday R.S., Coleman J.A., Vilsen B., Andersen J.P., Vestergaard A.L.", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "reference": [ { "type": "PubMed", "id": "22307598", "url": "https://glygen.org/publication/PubMed/22307598" } ] }, { "title": "P4-ATPase ATP8A2 acts in synergy with CDC50A to enhance neurite outgrowth.", "journal": "FEBS Lett.", "date": "2012", "authors": "Xu Q, Yang GY, Liu N, Xu P, Chen YL, Zhou Z, Luo ZG, Ding X", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "reference": [ { "type": "PubMed", "id": "22641037", "url": "https://glygen.org/publication/PubMed/22641037" } ] }, { "title": "Global identification and characterization of both O-GlcNAcylation and phosphorylation at the murine synapse.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Trinidad JC, Barkan DT, Gulledge BF, Thalhammer A, Sali A, Schoepfer R, Burlingame AL", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q8VEK0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8VEK0" } ], "reference": [ { "type": "PubMed", "id": "22645316", "url": "https://glygen.org/publication/PubMed/22645316" } ] }, { "title": "Role for phospholipid flippase complex of ATP8A1 and CDC50A proteins in cell migration.", "journal": "J. Biol. Chem.", "date": "2013", "authors": "Kato U, Inadome H, Yamamoto M, Emoto K, Kobayashi T, Umeda M", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "reference": [ { "type": "PubMed", "id": "23269685", "url": "https://glygen.org/publication/PubMed/23269685" } ] }, { "title": "Phospholipid flippase ATP8A2 is required for normal visual and auditory function and photoreceptor and spiral ganglion cell survival.", "journal": "J. Cell Sci.", "date": "2014", "authors": "Coleman JA, Zhu X, Djajadi HR, Molday LL, Smith RS, Libby RT, John SW, Molday RS", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "reference": [ { "type": "PubMed", "id": "24413176", "url": "https://glygen.org/publication/PubMed/24413176" } ] }, { "title": "Cell surface flip-flop of phosphatidylserine is critical for PIEZO1-mediated myotube formation.", "journal": "Nat. Commun.", "date": "2018", "authors": "Tsuchiya M, Hara Y, Okuda M, Itoh K, Nishioka R, Shiomi A, Nagao K, Mori M, Mori Y, Ikenouchi J, Suzuki R, Tanaka M, Ohwada T, Aoki J, Kanagawa M, Toda T, Nagata Y, Matsuda R, Takayama Y, Tominaga M, Umeda M", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "reference": [ { "type": "PubMed", "id": "29799007", "url": "https://glygen.org/publication/PubMed/29799007" } ] }, { "title": "Proteomic Analysis and Functional Characterization of P4-ATPase Phospholipid Flippases from Murine Tissues.", "journal": "Sci. Rep.", "date": "2018", "authors": "Wang J, Molday LL, Hii T, Coleman JA, Wen T, Andersen JP, Molday RS", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "reference": [ { "type": "PubMed", "id": "30018401", "url": "https://glygen.org/publication/PubMed/30018401" } ] }, { "title": "Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis.", "journal": "Nature communications", "date": "2019", "authors": "Riley NM, Hebert AS, Westphall MS, Coon JJ", "evidence": [ { "database": "GlyConnect", "id": "2201", "url": "https://glyconnect.expasy.org/browser/proteins/2201" } ], "reference": [ { "type": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "title": "O-GlcNAcylation regulates dopamine neuron function, survival and degeneration in Parkinson disease.", "journal": "Brain : a journal of neurology", "date": "2020", "authors": "Lee BE, Kim HY, Kim HJ, Jeong H, Kim BG, Lee HE, Lee J, Kim HB, Lee SE, Yang YR, Yi EC, Hanover JA, Myung K, Suh PG, Kwon T, Kim JI", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q8VEK0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8VEK0" } ], "reference": [ { "type": "PubMed", "id": "33300544", "url": "https://glygen.org/publication/PubMed/33300544" } ] }, { "title": "Phospholipid-flippase chaperone CDC50A is required for synapse maintenance by regulating phosphatidylserine exposure.", "journal": "The EMBO journal", "date": "2021", "authors": "Li T, Yu D, Oak HC, Zhu B, Wang L, Jiang X, Molday RS, Kriegstein A, Piao X", "evidence": [ { "database": "RefSeq", "id": "NP_598479", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598479" } ], "reference": [ { "type": "PubMed", "id": "34585770", "url": "https://glygen.org/publication/PubMed/34585770" } ] }, { "title": "TMEM30A is essential for hair cell polarity maintenance in postnatal mouse cochlea.", "journal": "Cellular & molecular biology letters", "date": "2023-03-23", "authors": "Xing Yazhi, Peng Kun, Yi Qian, Yu Dongzhen, Shi Haibo, Yang Guang, Yin Shankai", "evidence": [ { "database": "RefSeq", "id": "NP_598479", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598479" } ], "reference": [ { "type": "PubMed", "id": "36959542", "url": "https://glygen.org/publication/PubMed/36959542" } ] }, { "title": "Knockdown of TMEM30A in renal tubular epithelial cells leads to reduced glucose absorption.", "journal": "BMC nephrology", "date": "2023-08-23", "authors": "Chen Sipei, Song Xinrou, Xiao Qiong, Wang Li, Zhu Xianjun, Zou Yang, Li Guisen", "evidence": [ { "database": "RefSeq", "id": "NP_598479", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598479" } ], "reference": [ { "type": "PubMed", "id": "37612668", "url": "https://glygen.org/publication/PubMed/37612668" } ] } ], "pathway": [ { "id": "mmu:69981", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:69981", "resource": "KEGG Pathway" }, { "id": "R-MMU-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" } ], "orthologs": [ { "uniprot_canonical_ac": "P42838-1", "protein_name": "Phospholipid-transporting ATPase accessory subunit LEM3", "gene_name": "LEM3", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MVNFDLGQVGEVFRRKDKGAIVSGDNPEEEEDVDASEFEEDEVKPVRTKNRRPKEDAFTQQRLAAINPVLTPRTVLPLYLLIAVVFVIVGGCILAQNSKVDEVTIYYQDCMTNATSSWSDIPSEHWQFVFHKYKTYNTAPQWRFVDDESDDFTKQRGTCQIRFTTPSDMKNNVYLNYVLEKFAANHRRYVLSFSEDQIRGEDASYETVHDATGINCKPLSKNADGKIYYPCGLIANSMFNDTFPLQLTNVGDTSNNYSLTNKGINWESDKKRYKKTKYNYTQIAPPPYWEKMYPDGYNETNIPDIQDWEEFQNWMRPGAFDKITKLIRINKNDTLPAGEYQLDIGLHWPVLEFNGKKGIYLTHGSHLGGRNPFLGIVYLIGGCICAAMALILLTFWLFGGRKIADASSLSWNMK", "length": 414 }, "evidence": [ { "id": "Q8VEK0", "url": "https://omabrowser.org/oma/group/Q8VEK0/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q6AY41-1", "protein_name": "Cell cycle control protein 50A", "gene_name": "Tmem30a", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAMNYSAKDEVDGGPTGPPGGAAKTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIFIPIGIGIFVTSNNIREIEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLVANESDPKPVPILLKKKGIAWWTDKNVKFRNPPGKDSLQEKFKDTTKPVNWHKPVYELDPDDESNNGFINEDFIVWMRTAALPTFRKLYRLIERTDDLHPTLPAGQYYLNITYNYPVHFFDGRKRMILSTISWMGGKNPFLGIAYITIGSISFLLGVVLLVINHKYRNSSNTADITI", "length": 328 }, "evidence": [ { "id": "45225683", "url": "http://www.informatics.jax.org/homology/45225683", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9NV96-1", "protein_name": "Cell cycle control protein 50A", "gene_name": "TMEM30A", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADITI", "length": 361 }, "evidence": [ { "id": "45225683", "url": "http://www.informatics.jax.org/homology/45225683", "database": "MGI" }, { "id": "Q8VEK0", "url": "https://omabrowser.org/oma/group/Q8VEK0/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" }, { "name": "transport vesicle membrane", "id": "GO:0030658", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030658", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" }, { "name": "late endosome membrane", "id": "GO:0031902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031902", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" }, { "name": "early endosome membrane", "id": "GO:0031901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031901", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" }, { "name": "phospholipid-translocating ATPase complex", "id": "GO:1990531", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990531", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "positive regulation of neuron projection development", "id": "GO:0010976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010976", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" }, { "name": "phospholipid translocation", "id": "GO:0045332", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045332", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" }, { "name": "protein localization to endosome", "id": "GO:0036010", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036010", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" }, { "name": "xenobiotic transmembrane transport", "id": "GO:0006855", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006855", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" }, { "name": "positive regulation of phospholipid translocation", "id": "GO:0061092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061092", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" }, { "name": "positive regulation of protein exit from endoplasmic reticulum", "id": "GO:0070863", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070863", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" }, { "name": "aminophospholipid transport", "id": "GO:0015917", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015917", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" }, { "name": "macromolecule localization", "id": "GO:0033036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033036", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "structural molecule activity", "id": "GO:0005198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005198", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" }, { "name": "aminophospholipid flippase activity", "id": "GO:0015247", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015247", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 107, "end_pos": 109, "annotation": "n_glycosylation_sequon" }, { "start_pos": 180, "end_pos": 182, "annotation": "n_glycosylation_sequon" }, { "start_pos": 190, "end_pos": 192, "annotation": "n_glycosylation_sequon" }, { "start_pos": 297, "end_pos": 299, "annotation": "n_glycosylation_sequon" }, { "start_pos": 355, "end_pos": 357, "annotation": "n_glycosylation_sequon" }, { "start_pos": 4, "end_pos": 6, "annotation": "n_glycosylation_sequon" }, { "start_pos": 98, "end_pos": 100, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-glycosylated. Contains high mannose-type oligosaccharides.", "evidence": [ { "database": "UniProtKB", "id": "Q8VEK0", "url": "https://www.uniprot.org/uniprot/Q8VEK0" }, { "database": "PubMed", "id": "22253360", "url": "https://glygen.org/publication/PubMed/22253360" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 10 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 10 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }