{
    "uniprot_canonical_ac": "Q8VEB6-1",
    "uniprot_ac": "Q8VEB6",
    "uniprot_id": "RNZ1_MOUSE",
    "mass": {
        "chemical_mass": 39740.0,
        "monoisotopic_mass": 39740.0
    },
    "refseq": {
        "ac": "NP_444485",
        "name": "zinc phosphodiesterase ELAC protein 1",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444485"
    },
    "gene_names": [
        {
            "name": "Elac1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q8VEB6",
            "id": "Q8VEB6"
        },
        {
            "name": "2610018O07Rik; 8430417G19Rik",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444485",
            "id": "NP_444485"
        },
        {
            "name": "Elac1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444485",
            "id": "NP_444485"
        }
    ],
    "protein_names": [
        {
            "name": "Zinc phosphodiesterase ELAC protein 1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q8VEB6"
        },
        {
            "name": "3.1.26.11",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8VEB6"
        },
        {
            "name": "ElaC homolog protein 1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8VEB6"
        },
        {
            "name": "RNase Z 1; tRNase Z 1; ribonuclease Z 1; tRNA 3 endonuclease 1; elaC homolog protein 1; elaC homolog 1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444485",
            "id": "NP_444485"
        },
        {
            "name": "RNase Z 1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8VEB6"
        },
        {
            "name": "Ribonuclease Z 1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8VEB6"
        },
        {
            "name": "tRNA 3 endonuclease 1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8VEB6"
        },
        {
            "name": "tRNase Z 1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8VEB6"
        },
        {
            "name": "zinc phosphodiesterase ELAC protein 1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444485",
            "id": "NP_444485"
        }
    ],
    "function": [
        {
            "annotation": "Zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. Specifically involved in tRNA repair: acts downstream of the ribosome-associated quality control (RQC) pathway by removing a 2',3'-cyclic phosphate from tRNAs following cleavage by ANKZF1. tRNAs are then processed by TRNT1.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8VEB6",
                    "url": "https://www.uniprot.org/uniprot/Q8VEB6#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9H777",
                    "url": "https://www.uniprot.org/uniprot/Q9H777#function"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8VEB6",
                    "url": "https://www.uniprot.org/uniprot/Q8VEB6"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Elac1",
            "url": "https://www.uniprot.org/uniprot/Q8VEB6",
            "locus": {
                "chromosome": "18",
                "start_pos": 73868109,
                "end_pos": 73887550,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000036941",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000036941"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000036941",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000036941",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "cd07717",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07717",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "114615",
            "url": "https://www.ncbi.nlm.nih.gov/gene/114615",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR001279",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001279",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR013471",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013471",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036866",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036866",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:114615",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:114615",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "1890495",
            "url": "http://www.informatics.jax.org/marker/MGI:1890495",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "GTQRQMM",
            "url": "https://omabrowser.org/oma/group/GTQRQMM/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5471005at2759",
            "url": "http://www.orthodb.org/?query=5471005at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR46018",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46018",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR46018:SF2",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46018:SF2",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00753",
            "url": "http://pfam.xfam.org/family/PF00753",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF12706",
            "url": "http://pfam.xfam.org/family/PF12706",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q8VEB6",
            "url": "http://purl.obolibrary.org/obo/PR_Q8VEB6",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_444485",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444485",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8VEB6",
            "url": "https://www.uniprot.org/uniprot/Q8VEB6",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8VEB6-1",
            "url": "https://www.uniprot.org/uniprot/Q8VEB6-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8VEB6-2",
            "url": "https://www.uniprot.org/uniprot/Q8VEB6-2",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MSMDVTFLGTGAAYPSPTRGASAVVLRCEGECWLFDCGEGTQTQLMKSQLKAGRITKIFITHLHGDHFFGLPGLLCTISLQSGSVVARQPIEIYGPVGLRDFIWRTMELSHTELVFPYVVHELVPTADQCPVEELREFAHMDETDSSPKGQGRTILLDAEENSYCLVDDEQFVVKAFRLFHRIPSFGFSVVEKKRAGKLNAQKLRDLGVPPGPAYGKLKNGISVVLDNGVTISPQDVLKKPMVGRKVCILGDCSGVVGDGGVKLCFEADLLIHEATLDDSQMDKAREHGHSTPQMAAAFAKLCRAKRLVLTHFSQRYKPTALAREGEADGIAELRKQAEAVLELQEVTLAEDFMVIGIPIKK",
        "length": 362,
        "header": "sp|Q8VEB6-1|RNZ1_MOUSE Isoform 1 of Zinc phosphodiesterase ELAC protein 1  OS=Mus musculus OX=10090 GN=Elac1 PE=2 SV=1 CANONICAL=Q8VEB6-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q8VEB6-1",
            "url": "",
            "sequence": {
                "sequence": "MSMDVTFLGTGAAYPSPTRGASAVVLRCEGECWLFDCGEGTQTQLMKSQLKAGRITKIFITHLHGDHFFGLPGLLCTISLQSGSVVARQPIEIYGPVGLRDFIWRTMELSHTELVFPYVVHELVPTADQCPVEELREFAHMDETDSSPKGQGRTILLDAEENSYCLVDDEQFVVKAFRLFHRIPSFGFSVVEKKRAGKLNAQKLRDLGVPPGPAYGKLKNGISVVLDNGVTISPQDVLKKPMVGRKVCILGDCSGVVGDGGVKLCFEADLLIHEATLDDSQMDKAREHGHSTPQMAAAFAKLCRAKRLVLTHFSQRYKPTALAREGEADGIAELRKQAEAVLELQEVTLAEDFMVIGIPIKK",
                "length": 362,
                "header": "sp|Q8VEB6-1|RNZ1_MOUSE Isoform 1 of Zinc phosphodiesterase ELAC protein 1  OS=Mus musculus OX=10090 GN=Elac1 PE=2 SV=1 CANONICAL=Q8VEB6-1"
            },
            "locus": {
                "chromosome": "18",
                "start_pos": 73880394,
                "end_pos": 73871908,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000041138",
                        "url": "https://www.ensembl.org/id/ENSMUST00000041138"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000041793",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000041793"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q8VEB6-2",
            "url": "",
            "sequence": {
                "sequence": "MVGRKVCILGDCSGVVGDGGVKLCFEADLLIHEATLDDSQMDKAREHGHSTPQMAAAFAKLCRAKRLVLTHFSQRYKPTALAREGEADGIAELRKQAEAVLELQEVTLAEDFMVIGIPIKK",
                "length": 121,
                "header": "sp|Q8VEB6-2|RNZ1_MOUSE Isoform 2 of Zinc phosphodiesterase ELAC protein 1  OS=Mus musculus OX=10090 GN=Elac1 PE=2 SV=1 CANONICAL=Q8VEB6-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "enzyme"
    ],
    "publication": [
        {
            "title": "A candidate prostate cancer susceptibility gene at chromosome 17p.",
            "journal": "Nat. Genet.",
            "date": "2001",
            "authors": "Tavtigian SV, Simard J, Teng DH, Abtin V, Baumgard M, Beck A, Camp NJ, Carillo AR, Chen Y, Dayananth P, Desrochers M, Dumont M, Farnham JM, Frank D, Frye C, Ghaffari S, Gupte JS, Hu R, Iliev D, Janecki T, Kort EN, Laity KE, Leavitt A, Leblanc G, McArthur-Morrison J, Pederson A, Penn B, Peterson KT, Reid JE, Richards S, Schroeder M, Smith R, Snyder SC, Swedlund B, Swensen J, Thomas A, Tranchant M, Woodland AM, Labrie F, Skolnick MH, Neuhausen S, Rommens J, Cannon-Albright LA",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8VEB6",
                    "url": "https://www.uniprot.org/uniprot/Q8VEB6"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11175785",
                    "url": "https://glygen.org/publication/PubMed/11175785"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:114615",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:114615",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "D3ZB91-1",
            "protein_name": "ElaC ribonuclease Z 1",
            "gene_name": "Elac1",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MSMDVTFLGTGAAYPSPTRGASAVVLRCEGECWLFDCGEGTQTQLMKSQLKAGRITKIFITHLHGDHFFGLPGLLCTISLQSGSVVSRQPIEIYGPVGLRDFIWRTMELSHTELVFPYVVHELVPTADQCPVEELRESAQMDEADSSPKGQGRTILLDAEENSYCLVDDEQFVVKAFRLFHRIPSFGFSVVEKKRTGKLSAQKLRDLGVPPGPAYGKLKNGISVVLDNGVTISPQDVLKKPMVGRKVCILGDCSGVVGDGGVKLCFEADLLIHEATLDDSQMDKAKEHGHSTPQMAATFAKLCRAKRLVLTHFSQRYKPTALAREGEADGITELKKQAESVLELQEVTLAEDFMVIGIPIKK",
                "length": 362
            },
            "evidence": [
                {
                    "id": "45236749",
                    "url": "http://www.informatics.jax.org/homology/45236749",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        },
        {
            "uniprot_canonical_ac": "Q9H777-1",
            "protein_name": "Zinc phosphodiesterase ELAC protein 1",
            "gene_name": "ELAC1",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MSMDVTFLGTGAAYPSPTRGASAVVLRCEGECWLFDCGEGTQTQLMKSQLKAGRITKIFITHLHGDHFFGLPGLLCTISLQSGSMVSKQPIEIYGPVGLRDFIWRTMELSHTELVFHYVVHELVPTADQCPAEELKEFAHVNRADSPPKEEQGRTILLDSEENSYLLFDDEQFVVKAFRLFHRIPSFGFSVVEKKRPGKLNAQKLKDLGVPPGPAYGKLKNGISVVLENGVTISPQDVLKKPIVGRKICILGDCSGVVGDGGVKLCFEADLLIHEATLDDAQMDKAKEHGHSTPQMAATFAKLCRAKRLVLTHFSQRYKPVALAREGETDGIAELKKQAESVLDLQEVTLAEDFMVISIPIKK",
                "length": 363
            },
            "evidence": [
                {
                    "id": "45236749",
                    "url": "http://www.informatics.jax.org/homology/45236749",
                    "database": "MGI"
                },
                {
                    "id": "Q8VEB6",
                    "url": "https://omabrowser.org/oma/group/Q8VEB6/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 3,
                "go_terms": [
                    {
                        "name": "nucleus",
                        "id": "GO:0005634",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VEB6",
                                "url": "https://www.uniprot.org/uniprot/Q8VEB6"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nucleoplasm",
                        "id": "GO:0005654",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VEB6",
                                "url": "https://www.uniprot.org/uniprot/Q8VEB6"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytosol",
                        "id": "GO:0005829",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VEB6",
                                "url": "https://www.uniprot.org/uniprot/Q8VEB6"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 3,
                "go_terms": [
                    {
                        "name": "metal ion binding",
                        "id": "GO:0046872",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VEB6",
                                "url": "https://www.uniprot.org/uniprot/Q8VEB6"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "3'-tRNA processing endoribonuclease activity",
                        "id": "GO:0042781",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042781",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VEB6",
                                "url": "https://www.uniprot.org/uniprot/Q8VEB6"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "tRNA-specific ribonuclease activity",
                        "id": "GO:0004549",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004549",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VEB6",
                                "url": "https://www.uniprot.org/uniprot/Q8VEB6"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 1,
                "go_terms": [
                    {
                        "name": "tRNA 3'-end processing",
                        "id": "GO:0042780",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042780",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8VEB6",
                                "url": "https://www.uniprot.org/uniprot/Q8VEB6"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}