{ "uniprot_canonical_ac": "Q8VCX1-1", "uniprot_ac": "Q8VCX1", "uniprot_id": "AK1D1_MOUSE", "mass": { "chemical_mass": 37290.0, "monoisotopic_mass": 37290.0 }, "refseq": { "ac": "NP_663339", "name": "aldo-keto reductase family 1 member D1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663339" }, "gene_names": [ { "name": "Akr1d1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8VCX1", "id": "Q8VCX1" }, { "name": "Akr1d1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663339", "id": "NP_663339" } ], "protein_names": [ { "name": "Aldo-keto reductase family 1 member D1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8VCX1" }, { "name": "1.3.1.3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8VCX1" }, { "name": "3-oxo-5-beta-steroid 4-dehydrogenase; delta(4)-3-oxosteroid 5-beta-reductase; delta(4)-3-ketosteroid 5-beta-reductase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663339", "id": "NP_663339" }, { "name": "3-oxo-5-beta-steroid 4-dehydrogenase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8VCX1" }, { "name": "Delta(4)-3-ketosteroid 5-beta-reductase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8VCX1" }, { "name": "Delta(4)-3-oxosteroid 5-beta-reductase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8VCX1" }, { "name": "aldo-keto reductase family 1 member D1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663339", "id": "NP_663339" } ], "function": [ { "annotation": "Catalyzes the stereospecific NADPH-dependent reduction of the C4-C5 double bond of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure to yield an A/B cis-ring junction. This cis-configuration is crucial for bile acid biosynthesis and plays important roles in steroid metabolism. Capable of reducing a broad range of delta-(4)-3-ketosteroids from C18 (such as, 17beta-hydroxyestr-4-en-3-one) to C27 (such as, 7alpha-hydroxycholest-4-en-3-one).", "evidence": [ { "database": "UniProtKB", "id": "Q8VCX1", "url": "https://www.uniprot.org/uniprot/Q8VCX1#function" }, { "database": "UniProtKB", "id": "P51857", "url": "https://www.uniprot.org/uniprot/P51857#function" } ] } ], "disease": [ { "disease_id": "DOID:0111069", "recommended_name": { "id": "DOID:0111069", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111069", "name": "congenital bile acid synthesis defect 2", "description": "A congenital bile acid synthesis defect characterized by rapid progession of severe cholestatic liver disease, decreased levels of chenodeoxycholic acid and cholic acid in the serum and urine, and malabsorption of fat and fat-soluble vitamins that has_material_basis_in homozygous or compound heterozygous mutation in the AKR1D1 gene on chromosome 7q33." }, "synonyms": [ { "id": "DOID:0111069", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111069", "name": "cholestasis with delta(4)-3-oxosteroid 5-beta-reductase deficiency", "description": "" }, { "id": "DOID:0111069", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111069", "name": "CBAS2", "description": "" }, { "id": "MONDO:0009339", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009339", "name": "congenital bile acid synthesis defect 2", "description": "Congenital bile acid synthesis defect type 2 (BAS defect type 2) is an anomaly of bile acid synthesis characterized by severe and rapidly progressive cholestatic liver disease, and malabsorption of fat and fat-soluble vitamins." }, { "id": "MONDO:0009339", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009339", "name": "AKR1D1 congenital bile acid synthesis defect", "description": "" }, { "id": "MONDO:0009339", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009339", "name": "BASD2", "description": "" }, { "id": "MONDO:0009339", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009339", "name": "CBAS2", "description": "" }, { "id": "MONDO:0009339", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009339", "name": "bile acid synthesis defect, congenital, type 2", "description": "" }, { "id": "MONDO:0009339", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009339", "name": "cholestasis with delta(4)-3-oxosteroid 5-beta-reductase deficiency", "description": "" }, { "id": "MONDO:0009339", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009339", "name": "congenital bile acid synthesis defect caused by mutation in AKR1D1", "description": "" }, { "id": "MONDO:0009339", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009339", "name": "congenital bile acid synthesis defect type 2", "description": "" }, { "id": "MONDO:0009339", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009339", "name": "bile acid synthesis defect, congenital, 2", "description": "" }, { "id": "MONDO:0009339", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009339", "name": "cholestasis with Delta(4)-3-oxosteroid 5-Beta-reductase deficiency", "description": "" }, { "id": "MONDO:0009339", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009339", "name": "congenital bile acid synthesis defect, type 2", "description": "" }, { "id": "MIM:235555", "resource": "MIM", "url": "https://www.omim.org/entry/235555", "name": "Congenital bile acid synthesis defect 2", "description": "Congenital bile acid synthesis defect 2" } ], "evidence": [ { "id": "0111069", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0111069" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8VCX1", "url": "https://www.uniprot.org/uniprot/Q8VCX1" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Akr1d1", "url": "https://www.uniprot.org/uniprot/Q8VCX1", "locus": { "chromosome": "6", "start_pos": 37545750, "end_pos": 37507108, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000038641", "url": "https://www.ensembl.org/id/ENSMUSG00000038641" } ] } } ], "crossref": [ { "id": "ENSMUSG00000038641", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000038641", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd19109", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19109", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "208665", "url": "https://www.ncbi.nlm.nih.gov/gene/208665", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR018170", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018170", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020471", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020471", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023210", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023210", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036812", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036812", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044483", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044483", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:208665", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:208665", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2384785", "url": "http://www.informatics.jax.org/marker/MGI:2384785", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "NWVPLPK", "url": "https://omabrowser.org/oma/group/NWVPLPK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "890110at2759", "url": "http://www.orthodb.org/?query=890110at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11732", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11732", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11732:SF211", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11732:SF211", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00248", "url": "http://pfam.xfam.org/family/PF00248", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8VCX1", "url": "http://purl.obolibrary.org/obo/PR_Q8VCX1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-193368", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-193368", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-193775", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-193775", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-193807", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-193807", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_663339", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663339", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "11524", "url": "https://www.rhea-db.org/rhea/11524", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "14037", "url": "https://www.rhea-db.org/rhea/14037", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46632", "url": "https://www.rhea-db.org/rhea/46632", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46636", "url": "https://www.rhea-db.org/rhea/46636", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46640", "url": "https://www.rhea-db.org/rhea/46640", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46644", "url": "https://www.rhea-db.org/rhea/46644", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46652", "url": "https://www.rhea-db.org/rhea/46652", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46656", "url": "https://www.rhea-db.org/rhea/46656", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46660", "url": "https://www.rhea-db.org/rhea/46660", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46664", "url": "https://www.rhea-db.org/rhea/46664", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46668", "url": "https://www.rhea-db.org/rhea/46668", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46672", "url": "https://www.rhea-db.org/rhea/46672", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "47076", "url": "https://www.rhea-db.org/rhea/47076", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "47080", "url": "https://www.rhea-db.org/rhea/47080", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "53484", "url": "https://www.rhea-db.org/rhea/53484", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q8VCX1", "url": "https://www.uniprot.org/uniprot/Q8VCX1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8VCX1-1", "url": "https://www.uniprot.org/uniprot/Q8VCX1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNLSAAHHQISLSDGNNIPLIGLGTYSDPRPVPGKTYVAVKTAIDEGYRHIDGAYVYHNEHEVGEAIREKIAEGKVKREEIFYCGKLWNTEHVPSMVLPALERTLKALKLDYIDLYIIELPMAFKPGKEIYPRDENGRIIYDKTNLCATWEALEACKDAGLVKSLGVSNFNRRQLELILNKPGLKYKPVTNQVECHPYFTQTKLLKFCQQHDIVIVAHSPLGTCRNPSWVNVSSPPLLNDELLTSLGKKYNKTQAQIVLRFNIQRGIVVIPKSFTPERIKENFQIFDFSLTEEEMKDIDALNKNVRYVELLMWSDHPEYPFHDEY", "length": 325, "header": "sp|Q8VCX1-1|AK1D1_MOUSE Isoform 1 of Aldo-keto reductase family 1 member D1 OS=Mus musculus OX=10090 GN=Akr1d1 PE=1 SV=1 CANONICAL=Q8VCX1-1" }, "isoforms": [ { "isoform_ac": "Q8VCX1-1", "url": "", "sequence": { "sequence": "MNLSAAHHQISLSDGNNIPLIGLGTYSDPRPVPGKTYVAVKTAIDEGYRHIDGAYVYHNEHEVGEAIREKIAEGKVKREEIFYCGKLWNTEHVPSMVLPALERTLKALKLDYIDLYIIELPMAFKPGKEIYPRDENGRIIYDKTNLCATWEALEACKDAGLVKSLGVSNFNRRQLELILNKPGLKYKPVTNQVECHPYFTQTKLLKFCQQHDIVIVAHSPLGTCRNPSWVNVSSPPLLNDELLTSLGKKYNKTQAQIVLRFNIQRGIVVIPKSFTPERIKENFQIFDFSLTEEEMKDIDALNKNVRYVELLMWSDHPEYPFHDEY", "length": 325, "header": "sp|Q8VCX1-1|AK1D1_MOUSE Isoform 1 of Aldo-keto reductase family 1 member D1 OS=Mus musculus OX=10090 GN=Akr1d1 PE=1 SV=1 CANONICAL=Q8VCX1-1" }, "locus": { "chromosome": "6", "start_pos": 37544098, "end_pos": 37507180, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000040987", "url": "https://www.ensembl.org/id/ENSMUST00000040987" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000048830", "url": "https://www.ensembl.org/id/ENSMUSP00000048830" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 228, "end_pos": 228, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q8VCX1", "url": "https://www.uniprot.org/uniprot/Q8VCX1" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q8VCX1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8VCX1" } ], "site_lbl": "Ser228" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q8VCX1", "url": "https://www.uniprot.org/uniprot/Q8VCX1" }, { "database": "iPTMnet", "id": "Q8VCX1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8VCX1" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] } ], "pathway": [ { "id": "mmu:208665", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:208665", "resource": "KEGG Pathway" }, { "id": "R-MMU-193368", "name": "Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-193368", "resource": "Reactome", "description": "Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol" }, { "id": "R-MMU-193775", "name": "Synthesis of bile acids and bile salts via 24-hydroxycholesterol", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-193775", "resource": "Reactome", "description": "Synthesis of bile acids and bile salts via 24-hydroxycholesterol" }, { "id": "R-MMU-193807", "name": "Synthesis of bile acids and bile salts via 27-hydroxycholesterol", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-193807", "resource": "Reactome", "description": "Synthesis of bile acids and bile salts via 27-hydroxycholesterol" } ], "orthologs": [ { "uniprot_canonical_ac": "P31210-1", "protein_name": "Aldo-keto reductase family 1 member D1", "gene_name": "Akr1d1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MNLSTANHHIPLNDGNSIPIIGLGTYSDPRPVPGKTFIAVKTAIDEGYRHIDGAYVYRNEHEVGEAIREKVAEGKVKREEIFYCGKLWSTDHDPEMVRPALERTLQTLKLDYIDLYIIEMPMAFKPGEEFYPKDENGRVIYHKSNLCATWEALEACKDAGLVKSLGVSNFNRRQLEVILNKPGLKYKPVTNQVECHPYFTQTKLLEVSASSMTSFIVAYSPLGTCRNPLWVNVSSPPLLKDELLTSLGKKYNKTQAQIVLRFDIQRGLVVIPKSTTPERIKENFQIFDFSLTKEEMKDIEALNKNVRFVEMLMWSDHPEYPFHDEY", "length": 326 }, "evidence": [ { "id": "45240332", "url": "http://www.informatics.jax.org/homology/45240332", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P51857-1", "protein_name": "Aldo-keto reductase family 1 member D1", "gene_name": "AKR1D1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY", "length": 326 }, "evidence": [ { "id": "45240332", "url": "http://www.informatics.jax.org/homology/45240332", "database": "MGI" }, { "id": "Q8VCX1", "url": "https://omabrowser.org/oma/group/Q8VCX1/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "steroid dehydrogenase activity", "id": "GO:0016229", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016229", "evidence": [ { "database": "UniProtKB", "id": "Q8VCX1", "url": "https://www.uniprot.org/uniprot/Q8VCX1" } ], "pmid": "" }, { "name": "alditol:NADP+ 1-oxidoreductase activity", "id": "GO:0004032", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004032", "evidence": [ { "database": "UniProtKB", "id": "Q8VCX1", "url": "https://www.uniprot.org/uniprot/Q8VCX1" } ], "pmid": "" }, { "name": "delta4-3-oxosteroid 5beta-reductase activity", "id": "GO:0047787", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047787", "evidence": [ { "database": "UniProtKB", "id": "Q8VCX1", "url": "https://www.uniprot.org/uniprot/Q8VCX1" } ], "pmid": "" }, { "name": "ketosteroid monooxygenase activity", "id": "GO:0047086", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047086", "evidence": [ { "database": "UniProtKB", "id": "Q8VCX1", "url": "https://www.uniprot.org/uniprot/Q8VCX1" } ], "pmid": "" }, { "name": "3-oxo-5-beta-steroid 4-dehydrogenase activity", "id": "GO:0047568", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047568", "evidence": [ { "database": "UniProtKB", "id": "Q8VCX1", "url": "https://www.uniprot.org/uniprot/Q8VCX1" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q8VCX1", "url": "https://www.uniprot.org/uniprot/Q8VCX1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "bile acid biosynthetic process", "id": "GO:0006699", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006699", "evidence": [ { "database": "UniProtKB", "id": "Q8VCX1", "url": "https://www.uniprot.org/uniprot/Q8VCX1" } ], "pmid": "" }, { "name": "digestion", "id": "GO:0007586", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007586", "evidence": [ { "database": "UniProtKB", "id": "Q8VCX1", "url": "https://www.uniprot.org/uniprot/Q8VCX1" } ], "pmid": "" }, { "name": "cholesterol catabolic process", "id": "GO:0006707", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006707", "evidence": [ { "database": "UniProtKB", "id": "Q8VCX1", "url": "https://www.uniprot.org/uniprot/Q8VCX1" } ], "pmid": "" }, { "name": "C21-steroid hormone metabolic process", "id": "GO:0008207", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008207", "evidence": [ { "database": "UniProtKB", "id": "Q8VCX1", "url": "https://www.uniprot.org/uniprot/Q8VCX1" } ], "pmid": "" }, { "name": "androgen metabolic process", "id": "GO:0008209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008209", "evidence": [ { "database": "UniProtKB", "id": "Q8VCX1", "url": "https://www.uniprot.org/uniprot/Q8VCX1" } ], "pmid": "" }, { "name": "bile acid catabolic process", "id": "GO:0030573", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030573", "evidence": [ { "database": "UniProtKB", "id": "Q8VCX1", "url": "https://www.uniprot.org/uniprot/Q8VCX1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 231, "end_pos": 233, "annotation": "n_glycosylation_sequon" }, { "start_pos": 251, "end_pos": 253, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2, "end_pos": 4, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "11524", "name": "", "equation": "5beta-cholestan-3-one + NADP(+) = cholest-4-en-3-one + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P31210-1", "P51857-1", "Q8VCX1-1" ], "evidence": [ { "id": "11524", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/11524" } ] }, { "id": "14037", "name": "", "equation": "4,5beta-dihydrocortisone + NADP(+) = cortisone + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P31210-1", "P51857-1", "Q8VCX1-1" ], "evidence": [ { "id": "14037", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/14037" } ] }, { "id": "46632", "name": "", "equation": "7alpha,12alpha-dihydroxycholest-4-en-3-one + H(+) + NADPH = 7alpha,12alpha-dihydroxy-5beta-cholestan-3-one + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P31210-1", "P51857-1", "Q8VCX1-1" ], "evidence": [ { "id": "46632", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46632" } ] }, { "id": "46636", "name": "", "equation": "5beta-dihydrotestosterone + NADP(+) = H(+) + NADPH + testosterone", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P31210-1", "P51857-1", "Q8VCX1-1" ], "evidence": [ { "id": "46636", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46636" } ] }, { "id": "46640", "name": "", "equation": "7alpha-hydroxycholest-4-en-3-one + H(+) + NADPH = 7alpha-hydroxy-5beta-cholestan-3-one + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P31210-1", "P51857-1", "Q8VCX1-1" ], "evidence": [ { "id": "46640", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46640" } ] }, { "id": "46644", "name": "", "equation": "cortisol + H(+) + NADPH = 5beta-dihydrocortisol + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P31210-1", "P51857-1", "Q8VCX1-1" ], "evidence": [ { "id": "46644", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46644" } ] }, { "id": "46652", "name": "", "equation": "epitestosterone + H(+) + NADPH = 5beta-dihydroepitestosterone + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P31210-1", "P51857-1", "Q8VCX1-1" ], "evidence": [ { "id": "46652", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46652" } ] }, { "id": "46656", "name": "", "equation": "androst-4-ene-3,17-dione + H(+) + NADPH = 5beta-androstane-3,17-dione + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P31210-1", "P51857-1", "Q8VCX1-1" ], "evidence": [ { "id": "46656", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46656" } ] }, { "id": "46660", "name": "", "equation": "H(+) + NADPH + progesterone = 5beta-pregnan-3,20-dione + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P31210-1", "P51857-1", "Q8VCX1-1" ], "evidence": [ { "id": "46660", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46660" } ] }, { "id": "46664", "name": "", "equation": "corticosterone + H(+) + NADPH = 5beta-dihydrocorticosterone + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P31210-1", "P51857-1", "Q8VCX1-1" ], "evidence": [ { "id": "46664", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46664" } ] }, { "id": "46668", "name": "", "equation": "21-hydroxyprogesterone + H(+) + NADPH = 5beta-dihydrodeoxycorticosterone + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P31210-1", "P51857-1", "Q8VCX1-1" ], "evidence": [ { "id": "46668", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46668" } ] }, { "id": "46672", "name": "", "equation": "aldosterone + H(+) + NADPH = 5beta-dihydroaldosterone + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P31210-1", "P51857-1", "Q8VCX1-1" ], "evidence": [ { "id": "46672", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46672" } ] }, { "id": "47076", "name": "", "equation": "17beta-hydroxyandrosta-1,4-dien-3-one + H(+) + NADPH = 17beta-hydroxy-5beta-androst-1-en-3-one + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P31210-1", "P51857-1", "Q8VCX1-1" ], "evidence": [ { "id": "47076", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/47076" } ] }, { "id": "47080", "name": "", "equation": "17beta-hydroxyestr-4-en-3-one + H(+) + NADPH = 17beta-hydroxy-5beta-estran-3-one + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P31210-1", "P51857-1", "Q8VCX1-1" ], "evidence": [ { "id": "47080", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/47080" } ] }, { "id": "53484", "name": "", "equation": "androst-4-ene-3,11,17-trione + H(+) + NADPH = 17beta-hydroxyandrost-4-ene-3,11-dione + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P31210-1", "O54939-1", "P51857-1", "P37058-1", "Q8VCX1-1", "P70385-1" ], "evidence": [ { "id": "53484", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/53484" } ] }, { "id": "R-MMU-192033", "name": "4-cholesten-7alpha-ol-3-one is reduced to 5beta-cholestan-7alpha-ol-3-one", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-191980" ], "enzyme_list": [ "Q8VCX1-1" ], "evidence": [ { "id": "R-MMU-192033", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-192033" } ] }, { "id": "R-MMU-192067", "name": "4-cholesten-7alpha, 12alpha-diol-3-one is reduced to 5beta-cholesten-7alpha, 12alpha-diol-3-one", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-192064" ], "enzyme_list": [ "Q8VCX1-1" ], "evidence": [ { "id": "R-MMU-192067", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-192067" } ] }, { "id": "R-MMU-193746", "name": "4-cholesten-7alpha,24(S)-diol-3-one is reduced to 5beta-cholestan-7alpha,24(S)-diol-3-one", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-193760" ], "enzyme_list": [ "Q8VCX1-1" ], "evidence": [ { "id": "R-MMU-193746", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-193746" } ] }, { "id": "R-MMU-193755", "name": "4-cholesten-7alpha,12alpha,24(S)-triol-3-one is reduced to 5beta-cholestan-7alpha,12alpha,24(S)-triol-3-one", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-193707" ], "enzyme_list": [ "Q8VCX1-1" ], "evidence": [ { "id": "R-MMU-193755", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-193755" } ] }, { "id": "R-MMU-193821", "name": "4-cholesten-7alpha,12alpha,27-triol-3-one is reduced to 5beta-cholestan-7alpha,12alpha,27-triol-3-one", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-193829" ], "enzyme_list": [ "Q8VCX1-1" ], "evidence": [ { "id": "R-MMU-193821", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-193821" } ] }, { "id": "R-MMU-193824", "name": "4-cholesten-7alpha,27-diol-3-one is reduced to 5beta-cholestan-7alpha,27-diol-3-one", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-193830" ], "enzyme_list": [ "Q8VCX1-1" ], "evidence": [ { "id": "R-MMU-193824", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-193824" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-191980", "participant_name": "5beta-cholestan-7alpha-ol-3-one [cytosol]", "crossref": [ { "id": "HMDB0006892", "database": "HMDB Metabolite", "url": "" }, { "id": "2290", "database": "ChEBI", "url": "" }, { "id": "C05451", "database": "COMPOUND", "url": "" }, { "id": "000013543210", "database": "ZINC", "url": "" }, { "id": "C05451", "database": "COMPOUND", "url": "" }, { "id": "2290", "database": "ChEBI", "url": "" }, { "id": "000013543210", "database": "ZINC", "url": "" }, { "id": "HMDB0006892", "database": "HMDB Metabolite", "url": "" }, { "id": "000013543210", "database": "ZINC", "url": "" }, { "id": "C05451", "database": "COMPOUND", "url": "" }, { "id": "HMDB0006892", "database": "HMDB Metabolite", "url": "" }, { "id": "2290", "database": "ChEBI", "url": "" }, { "id": "C05451", "database": "COMPOUND", "url": "" }, { "id": "2290", "database": "ChEBI", "url": "" }, { "id": "000013543210", "database": "ZINC", "url": "" }, { "id": "HMDB0006892", "database": "HMDB Metabolite", "url": "" }, { "id": "C05451", "database": "COMPOUND", "url": "" }, { "id": "000013543210", "database": "ZINC", "url": "" }, { "id": "HMDB0006892", "database": "HMDB Metabolite", "url": "" }, { "id": "2290", "database": "ChEBI", "url": "" }, { "id": "C05451", "database": "COMPOUND", "url": "" }, { "id": "2290", "database": "ChEBI", "url": "" }, { "id": "000013543210", "database": "ZINC", "url": "" }, { "id": "HMDB0006892", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-192064", "participant_name": "5beta-cholesten-7alpha, 12alpha-diol-3-one [cytosol]", "crossref": [ { "id": "000013543186", "database": "ZINC", "url": "" }, { "id": "C05453", "database": "COMPOUND", "url": "" }, { "id": "2288", "database": "ChEBI", "url": "" }, { "id": "C05453", "database": "COMPOUND", "url": "" }, { "id": "2288", "database": "ChEBI", "url": "" }, { "id": "000013543186", "database": "ZINC", "url": "" }, { "id": "2288", "database": "ChEBI", "url": "" }, { "id": "C05453", "database": "COMPOUND", "url": "" }, { "id": "000013543186", "database": "ZINC", "url": "" }, { "id": "C05453", "database": "COMPOUND", "url": "" }, { "id": "2288", "database": "ChEBI", "url": "" }, { "id": "000013543186", "database": "ZINC", "url": "" }, { "id": "2288", "database": "ChEBI", "url": "" }, { "id": "000013543186", "database": "ZINC", "url": "" }, { "id": "C05453", "database": "COMPOUND", "url": "" }, { "id": "C05453", "database": "COMPOUND", "url": "" }, { "id": "2288", "database": "ChEBI", "url": "" }, { "id": "000013543186", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-193707", "participant_name": "5beta-cholestan-7alpha,12alpha,24(S)-triol-3-one [cytosol]", "crossref": [ { "id": "63830", "database": "ChEBI", "url": "" }, { "id": "000064624760", "database": "ZINC", "url": "" }, { "id": "63830", "database": "ChEBI", "url": "" }, { "id": "000064624760", "database": "ZINC", "url": "" }, { "id": "63830", "database": "ChEBI", "url": "" }, { "id": "000064624760", "database": "ZINC", "url": "" }, { "id": "63830", "database": "ChEBI", "url": "" }, { "id": "000064624760", "database": "ZINC", "url": "" }, { "id": "63830", "database": "ChEBI", "url": "" }, { "id": "000064624760", "database": "ZINC", "url": "" }, { "id": "63830", "database": "ChEBI", "url": "" }, { "id": "000064624760", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-193760", "participant_name": "5beta-cholestan-7alpha,24(S)-diol-3-one [cytosol]", "crossref": [ { "id": "000059789229", "database": "ZINC", "url": "" }, { "id": "63829", "database": "ChEBI", "url": "" }, { "id": "63829", "database": "ChEBI", "url": "" }, { "id": "000059789229", "database": "ZINC", "url": "" }, { "id": "63829", "database": "ChEBI", "url": "" }, { "id": "000059789229", "database": "ZINC", "url": "" }, { "id": "63829", "database": "ChEBI", "url": "" }, { "id": "000059789229", "database": "ZINC", "url": "" }, { "id": "63829", "database": "ChEBI", "url": "" }, { "id": "000059789229", "database": "ZINC", "url": "" }, { "id": "63829", "database": "ChEBI", "url": "" }, { "id": "000059789229", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-193829", "participant_name": "5beta-cholestan-7alpha,12alpha,27-triol-3-one [cytosol]", "crossref": [ { "id": "000064624809", "database": "ZINC", "url": "" }, { "id": "48834", "database": "ChEBI", "url": "" }, { "id": "000064624808", "database": "ZINC", "url": "" }, { "id": "48834", "database": "ChEBI", "url": "" }, { "id": "000064624809", "database": "ZINC", "url": "" }, { "id": "000064624808", "database": "ZINC", "url": "" }, { "id": "48834", "database": "ChEBI", "url": "" }, { "id": "000064624808", "database": "ZINC", "url": "" }, { "id": "000064624809", "database": "ZINC", "url": "" }, { "id": "48834", "database": "ChEBI", "url": "" }, { "id": "000064624809", "database": "ZINC", "url": "" }, { "id": "000064624808", "database": "ZINC", "url": "" }, { "id": "000064624809", "database": "ZINC", "url": "" }, { "id": "48834", "database": "ChEBI", "url": "" }, { "id": "000064624808", "database": "ZINC", "url": "" }, { "id": "48834", "database": "ChEBI", "url": "" }, { "id": "000064624809", "database": "ZINC", "url": "" }, { "id": "000064624808", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-193830", "participant_name": "5beta-cholestan-7alpha,27-diol-3-one [cytosol]", "crossref": [ { "id": "000059789393", "database": "ZINC", "url": "" }, { "id": "HMDB0062420", "database": "HMDB Metabolite", "url": "" }, { "id": "000059789397", "database": "ZINC", "url": "" }, { "id": "48778", "database": "ChEBI", "url": "" }, { "id": "48778", "database": "ChEBI", "url": "" }, { "id": "000059789393", "database": "ZINC", "url": "" }, { "id": "000059789397", "database": "ZINC", "url": "" }, { "id": "HMDB0062420", "database": "HMDB Metabolite", "url": "" }, { "id": "000059789397", "database": "ZINC", "url": "" }, { "id": "48778", "database": "ChEBI", "url": "" }, { "id": "HMDB0062420", "database": "HMDB Metabolite", "url": "" }, { "id": "000059789393", "database": "ZINC", "url": "" }, { "id": "48778", "database": "ChEBI", "url": "" }, { "id": "000059789393", "database": "ZINC", "url": "" }, { "id": "000059789397", "database": "ZINC", "url": "" }, { "id": "HMDB0062420", "database": "HMDB Metabolite", "url": "" }, { "id": "000059789397", "database": "ZINC", "url": "" }, { "id": "48778", "database": "ChEBI", "url": "" }, { "id": "HMDB0062420", "database": "HMDB Metabolite", "url": "" }, { "id": "000059789393", "database": "ZINC", "url": "" }, { "id": "48778", "database": "ChEBI", "url": "" }, { "id": "000059789393", "database": "ZINC", "url": "" }, { "id": "000059789397", "database": "ZINC", "url": "" }, { "id": "HMDB0062420", "database": "HMDB Metabolite", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O54939", "gene_name": "Hsd17b3", "activity": [ { "ec_number": "1.1.1.62", "activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.", "evidence": [ { "id": "O54939", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54939" } ] }, { "ec_number": "1.1.1.64", "activity": "NADP(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADPH.", "evidence": [ { "id": "O54939", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54939" } ] } ] }, { "uniprot_ac": "P31210", "gene_name": "Akr1d1", "activity": [ { "ec_number": "1.3.1.3", "activity": "a 3-oxo-5beta-steroid + NADP(+) = a 3-oxo-Delta(4)-steroid + H(+) + NADPH.", "evidence": [ { "id": "P31210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31210" } ] }, { "ec_number": "1.3.1.3", "activity": "", "evidence": [ { "id": "P31210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31210" } ] } ] }, { "uniprot_ac": "P37058", "gene_name": "HSD17B3", "activity": [ { "ec_number": "1.1.1.62", "activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.", "evidence": [ { "id": "P37058", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P37058" } ] }, { "ec_number": "1.1.1.64", "activity": "NADP(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADPH.", "evidence": [ { "id": "P37058", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P37058" } ] } ] }, { "uniprot_ac": "P51857", "gene_name": "AKR1D1", "activity": [ { "ec_number": "1.3.1.3", "activity": "a 3-oxo-5beta-steroid + NADP(+) = a 3-oxo-Delta(4)-steroid + H(+) + NADPH.", "evidence": [ { "id": "P51857", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51857" } ] }, { "ec_number": "1.3.1.3", "activity": "", "evidence": [ { "id": "P51857", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51857" } ] } ] }, { "uniprot_ac": "P70385", "gene_name": "Hsd17b3", "activity": [ { "ec_number": "1.1.1.62", "activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.", "evidence": [ { "id": "P70385", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70385" } ] }, { "ec_number": "1.1.1.64", "activity": "NADP(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADPH.", "evidence": [ { "id": "P70385", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70385" } ] } ] }, { "uniprot_ac": "Q8VCX1", "gene_name": "Akr1d1", "activity": [ { "ec_number": "1.3.1.3", "activity": "a 3-oxo-5beta-steroid + NADP(+) = a 3-oxo-Delta(4)-steroid + H(+) + NADPH.", "evidence": [ { "id": "Q8VCX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCX1" } ] }, { "ec_number": "1.3.1.3", "activity": "", "evidence": [ { "id": "Q8VCX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCX1" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }