{ "uniprot_canonical_ac": "Q8VCI7-1", "uniprot_ac": "Q8VCI7", "uniprot_id": "SWAP1_MOUSE", "mass": { "chemical_mass": 29385.0, "monoisotopic_mass": 29385.0 }, "refseq": { "ac": "NP_080146", "name": "ATPase SWSAP1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080146" }, "gene_names": [ { "name": "Swsap1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8VCI7", "id": "Q8VCI7" }, { "name": "2310047B19Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080146", "id": "NP_080146" }, { "name": "Swsap1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080146", "id": "NP_080146" } ], "protein_names": [ { "name": "ATPase SWSAP1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8VCI7" }, { "name": "ATPase SWSAP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080146", "id": "NP_080146" } ], "function": [ { "annotation": "ATPase which is preferentially stimulated by single-stranded DNA and is involved in homologous recombination repair (HRR). Has a DNA-binding activity which is independent of its ATPase activity (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q8VCI7", "url": "https://www.uniprot.org/uniprot/Q8VCI7#function" } ] }, { "annotation": "Distinct pathways of homologous recombination controlled by the SWS1-SWSAP1-SPIDR complex. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_080146", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080146" }, { "database": "PubMed", "id": "34253720", "url": "https://glygen.org/publication/PubMed/34253720" } ] }, { "annotation": "These results demonstrate an essential role for SWS1-SWSAP1 in meiotic progression and emphasize the complex interplay of factors that ensure recombinase function. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_080146", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080146" }, { "database": "PubMed", "id": "30305635", "url": "https://glygen.org/publication/PubMed/30305635" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8VCI7", "url": "https://www.uniprot.org/uniprot/Q8VCI7" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Swsap1", "url": "https://www.uniprot.org/uniprot/Q8VCI7", "locus": { "chromosome": "9", "start_pos": 21869560, "end_pos": 21867051, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000051238", "url": "https://www.ensembl.org/id/ENSMUSG00000051238" } ] } } ], "crossref": [ { "id": "ENSMUSG00000051238", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000051238", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "66962", "url": "https://www.ncbi.nlm.nih.gov/gene/66962", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "mmu:66962", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66962", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1914212", "url": "http://www.informatics.jax.org/marker/MGI:1914212", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "EMTITPW", "url": "https://omabrowser.org/oma/group/EMTITPW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5356400at2759", "url": "http://www.orthodb.org/?query=5356400at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR28653:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28653:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8VCI7", "url": "http://purl.obolibrary.org/obo/PR_Q8VCI7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_080146", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080146", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q8VCI7", "url": "https://www.uniprot.org/uniprot/Q8VCI7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8VCI7-1", "url": "https://www.uniprot.org/uniprot/Q8VCI7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAEALRRVLNAGCAARPGEDGAAGPPLLLLGAPRSAQTSLLFAAALEAAGEGRGSVLFVTRRPLQSLPLSTPTAREHWRLQKVRFQYPSSIQELLQLLASAHEAPAPTPSLLLLDGLEEYLAEDPSAQEAAYLAALLLDTAAFFSHRLGANGSCGLVVALETQKEAEADAPHLPLLKRYFPAQCWLQPDALGLGQHCCLRASLELGKLSPRTEWSVSFLPCGEMKVTPWLAQASKLSPEKKDSSAGSQSLTLGCDNLPGPGSPLDGILTSETGADSKT", "length": 278, "header": "sp|Q8VCI7-1|SWAP1_MOUSE Isoform 1 of ATPase SWSAP1 OS=Mus musculus OX=10090 GN=Swsap1 PE=2 SV=2 CANONICAL=Q8VCI7-1" }, "isoforms": [ { "isoform_ac": "Q8VCI7-1", "url": "", "sequence": { "sequence": "MAEALRRVLNAGCAARPGEDGAAGPPLLLLGAPRSAQTSLLFAAALEAAGEGRGSVLFVTRRPLQSLPLSTPTAREHWRLQKVRFQYPSSIQELLQLLASAHEAPAPTPSLLLLDGLEEYLAEDPSAQEAAYLAALLLDTAAFFSHRLGANGSCGLVVALETQKEAEADAPHLPLLKRYFPAQCWLQPDALGLGQHCCLRASLELGKLSPRTEWSVSFLPCGEMKVTPWLAQASKLSPEKKDSSAGSQSLTLGCDNLPGPGSPLDGILTSETGADSKT", "length": 278, "header": "sp|Q8VCI7-1|SWAP1_MOUSE Isoform 1 of ATPase SWSAP1 OS=Mus musculus OX=10090 GN=Swsap1 PE=2 SV=2 CANONICAL=Q8VCI7-1" }, "locus": { "chromosome": "9", "start_pos": 21868563, "end_pos": 21867058, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000053583", "url": "https://www.ensembl.org/id/ENSMUST00000053583" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000060331", "url": "https://www.ensembl.org/id/ENSMUSP00000060331" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Shu complex SWS1-SWSAP1 promotes early steps in mouse meiotic recombination.", "journal": "Nature communications", "date": "2018", "authors": "Abreu CM, Prakash R, Romanienko PJ, Roig I, Keeney S, Jasin M", "evidence": [ { "database": "RefSeq", "id": "NP_080146", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080146" } ], "reference": [ { "type": "PubMed", "id": "30305635", "url": "https://glygen.org/publication/PubMed/30305635" } ] }, { "title": "Distinct pathways of homologous recombination controlled by the SWS1-SWSAP1-SPIDR complex.", "journal": "Nature communications", "date": "2021", "authors": "Prakash R, Sandoval T, Morati F, Zagelbaum JA, Lim PX, White T, Taylor B, Wang R, Desclos ECB, Sullivan MR, Rein HL, Bernstein KA, Krawczyk PM, Gautier J, Modesti M, Vanoli F, Jasin M", "evidence": [ { "database": "RefSeq", "id": "NP_080146", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080146" } ], "reference": [ { "type": "PubMed", "id": "34253720", "url": "https://glygen.org/publication/PubMed/34253720" } ] } ], "pathway": [ { "id": "mmu:66962", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66962", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q6NVH7-1", "protein_name": "ATPase SWSAP1", "gene_name": "SWSAP1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPAAGPPLLLLGTPGSGKTALLFAAALEAAGEGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLDTAAHFSHRLGPGRDCGLMVALQTQEEAGSGDVLHLALLQRYFPAQCWLQPDAPGPGEHGLRACLEPGGLGPRTEWWVTFRSDGEMMIAPWPTQAGDPSSGKGSSSGGQP", "length": 229 }, "evidence": [ { "id": "45229425", "url": "http://www.informatics.jax.org/homology/45229425", "database": "MGI" }, { "id": "Q8VCI7", "url": "https://omabrowser.org/oma/group/Q8VCI7/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q8VCI7", "url": "https://www.uniprot.org/uniprot/Q8VCI7" } ], "pmid": "" }, { "name": "Shu complex", "id": "GO:0097196", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097196", "evidence": [ { "database": "UniProtKB", "id": "Q8VCI7", "url": "https://www.uniprot.org/uniprot/Q8VCI7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "ATP hydrolysis activity", "id": "GO:0016887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016887", "evidence": [ { "database": "UniProtKB", "id": "Q8VCI7", "url": "https://www.uniprot.org/uniprot/Q8VCI7" } ], "pmid": "" }, { "name": "single-stranded DNA binding", "id": "GO:0003697", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003697", "evidence": [ { "database": "UniProtKB", "id": "Q8VCI7", "url": "https://www.uniprot.org/uniprot/Q8VCI7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "protein stabilization", "id": "GO:0050821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050821", "evidence": [ { "database": "UniProtKB", "id": "Q8VCI7", "url": "https://www.uniprot.org/uniprot/Q8VCI7" } ], "pmid": "" }, { "name": "double-strand break repair via homologous recombination", "id": "GO:0000724", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000724", "evidence": [ { "database": "UniProtKB", "id": "Q8VCI7", "url": "https://www.uniprot.org/uniprot/Q8VCI7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 151, "end_pos": 153, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }