{ "uniprot_canonical_ac": "Q8TGJ1-1", "uniprot_ac": "Q8TGJ1", "uniprot_id": "YO16A_YEAST", "mass": { "chemical_mass": 5952.0, "monoisotopic_mass": 5952.0 }, "refseq": { "ac": "NP_878160", "name": "uncharacterized protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_878160" }, "gene_names": [], "protein_names": [ { "name": "UPF0320 protein YOL166W-A", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8TGJ1" }, { "name": "uncharacterized protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_878160", "id": "NP_878160" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q8TGJ1", "url": "https://www.uniprot.org/uniprot/Q8TGJ1" } ], "common_name": "Yeast" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/Q8TGJ1", "locus": {} } ], "crossref": [ { "id": "1466472", "url": "https://www.ncbi.nlm.nih.gov/gene/1466472", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR007414", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007414", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YOL166W-A", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YOL166W-A", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "5498144at2759", "url": "http://www.orthodb.org/?query=5498144at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PF04318", "url": "http://pfam.xfam.org/family/PF04318", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8TGJ1", "url": "http://purl.obolibrary.org/obo/PR_Q8TGJ1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_878160", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_878160", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000028709", "url": "https://www.yeastgenome.org/locus/S000028709", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q8TGJ1", "url": "https://www.uniprot.org/uniprot/Q8TGJ1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8TGJ1-1", "url": "https://www.uniprot.org/uniprot/Q8TGJ1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MHGACLSGLYPLPFTHKFHDYLHFNIYISFGGPKYCITALNTYVILFYTVY", "length": 51, "header": "sp|Q8TGJ1-1|YO16A_YEAST Isoform 1 of UPF0320 protein YOL166W-A OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=3 SV=1 CANONICAL=Q8TGJ1-1" }, "isoforms": [ { "isoform_ac": "Q8TGJ1-1", "url": "", "sequence": { "sequence": "MHGACLSGLYPLPFTHKFHDYLHFNIYISFGGPKYCITALNTYVILFYTVY", "length": 51, "header": "sp|Q8TGJ1-1|YO16A_YEAST Isoform 1 of UPF0320 protein YOL166W-A OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=3 SV=1 CANONICAL=Q8TGJ1-1" }, "locus": { "chromosome": "XV", "start_pos": 737, "end_pos": 585, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YOL166W-A_mRNA", "url": "https://www.ensembl.org/id/YOL166W-A_mRNA" }, { "database": "Ensembl Peptide", "id": "YOL166W-A", "url": "https://www.ensembl.org/id/YOL166W-A" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "An integrated approach for finding overlooked genes in yeast.", "journal": "Nat. Biotechnol.", "date": "2002", "authors": "Kumar A., Snyder M., Miller P., Harrison P.M., Cheung K.-H., Bertone P., Echols N., Gerstein M.B., Lan N.", "evidence": [ { "database": "UniProtKB", "id": "Q8TGJ1", "url": "https://www.uniprot.org/uniprot/Q8TGJ1" } ], "reference": [ { "type": "PubMed", "id": "11753363", "url": "https://glygen.org/publication/PubMed/11753363" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q8TGJ1", "url": "https://www.uniprot.org/uniprot/Q8TGJ1" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Mewes H.-W., Wambutt R., Wedler H., Wiemann S., Pujol A., Uhlen M., Camasses A., Poch O., Benes V., Durand P., Vlcek C., Winsor B., Landt O., Portetelle D., Casas C., Lafuente M.J., Paces V., Delius H., Michaux G., Schweizer M., Feldmann H., Kleine K., Martin R.P., Hofmann B., Schwager C., Voss H., Cziepluch C., Jauniaux J.-C., Hughes B., Galisson F., Volckaert G., Hattenhorst U., Cheret G., Sor F., Herrero E., Arino J., Vetter I., Casamayor A., Bordonne R., Perrin A., Thierry A., Kordes E., Louis E.J., Hollenberg C.P., Maarse A.C., Marck C., Vandenbol M., Pohl T.M., Tobiasch E., Pearson B.M., Poirey R., Hand N.J., Goulding S.E., Daignan-Fornier B., Dujon B., Goffeau A., Grivell L.A., Hani J., Hernando Y., Hilger F., Madania A., Mannhaupt G., Zollner A., Aldea M., Alexandraki D., Bolotin-Fukuhara M., Fairhead C., Gancedo C., Purnelle B., Ramezani Rad M., Tarassov I.A., Tzermia M., Voet M., Albermann K., Bohn C., Boyer J., Dang V.-D., Gaillon L., Gamo F.-J., Habbig B., Hebling U., Heumann K., Hiesel R., Kalogeropoulos A., Katsoulou C., Parle-McDermott A.G., Pettersson B., Rechmann S., Sterky F., Teodoru C., Tettelin H., Unseld M., Valens M., Wolfe K.H., Zumstein E., de Haan M.", "evidence": [ { "database": "UniProtKB", "id": "Q8TGJ1", "url": "https://www.uniprot.org/uniprot/Q8TGJ1" } ], "reference": [ { "type": "PubMed", "id": "9169874", "url": "https://glygen.org/publication/PubMed/9169874" } ] } ], "pathway": [ { "id": "sce:YOL166W-A", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YOL166W-A", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }