{ "uniprot_canonical_ac": "Q8SY96-1", "uniprot_ac": "Q8SY96", "uniprot_id": "NFU1_DROME", "mass": { "chemical_mass": 31296.0, "monoisotopic_mass": 31296.0 }, "refseq": { "ac": "NP_728443", "name": "uncharacterized protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_728443" }, "gene_names": [ { "name": "CG32500", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q8SY96", "id": "Q8SY96" }, { "name": "CG32857", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_728443", "id": "NP_728443" }, { "name": "CG32857", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q8SY96", "id": "Q8SY96" }, { "name": "CG33502", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q8SY96", "id": "Q8SY96" }, { "name": "Dmel\\CG32857; Nfu", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_728443", "id": "NP_728443" } ], "protein_names": [ { "name": "NFU1 iron-sulfur cluster scaffold homolog, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8SY96" }, { "name": "CG32857-PA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_728443", "id": "NP_728443" }, { "name": "uncharacterized protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_728443", "id": "NP_728443" } ], "function": [ { "annotation": "Molecular scaffold for [Fe-S] cluster assembly of mitochondrial iron-sulfur proteins.", "evidence": [ { "database": "UniProtKB", "id": "Q8SY96", "url": "https://www.uniprot.org/uniprot/Q8SY96#function" }, { "database": "UniProtKB", "id": "Q9UMS0", "url": "https://www.uniprot.org/uniprot/Q9UMS0#function" } ] } ], "disease": [ { "disease_id": "DOID:0080133", "recommended_name": { "id": "DOID:0080133", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080133", "name": "multiple mitochondrial dysfunctions syndrome 1", "description": "A multiple mitochondrial dysfunctions syndrome that is characterized by weakness, respiratory failure, lack of neurologic development, lactic acidosis, and early death, and has_material_basis_in autosomal recessive inheritance of homozygous or compound heterozygous mutation in the NFU1 iron-sulfur cluster scaffold gene on chromosome 2p13." }, "synonyms": [ { "id": "DOID:0080133", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080133", "name": "NFU1 deficiency", "description": "" }, { "id": "MONDO:0011582", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011582", "name": "multiple mitochondrial dysfunctions syndrome 1", "description": "Any fatal multiple mitochondrial dysfunctions syndrome in which the cause of the disease is a mutation in the NFU1 gene." }, { "id": "MONDO:0011582", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011582", "name": "Mmds", "description": "" }, { "id": "MONDO:0011582", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011582", "name": "NFU1 deficiency", "description": "" }, { "id": "MONDO:0011582", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011582", "name": "NFU1 fatal multiple mitochondrial dysfunctions syndrome", "description": "" }, { "id": "MONDO:0011582", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011582", "name": "fatal multiple mitochondrial dysfunctions syndrome caused by mutation in NFU1", "description": "" }, { "id": "MONDO:0011582", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011582", "name": "multiple mitochondrial dysfunctions syndrome 1", "description": "" }, { "id": "MONDO:0011582", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011582", "name": "multiple mitochondrial dysfunctions syndrome type 1", "description": "" }, { "id": "MONDO:0011582", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011582", "name": "MMDS1", "description": "" }, { "id": "MIM:605711", "resource": "MIM", "url": "https://www.omim.org/entry/605711", "name": "Multiple mitochondrial dysfunctions syndrome 1", "description": "Multiple mitochondrial dysfunctions syndrome 1" } ], "evidence": [ { "id": "0080133", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080133" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q8SY96", "url": "https://www.uniprot.org/uniprot/Q8SY96" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/Q8SY96", "locus": {} } ], "crossref": [ { "id": "FBgn0052857", "url": "https://bgee.org/?page=gene&gene_id=FBgn0052857", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FBgn0052857", "url": "https://flybase.org/reports/FBgn0052857", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "FBgn0053502", "url": "https://flybase.org/reports/FBgn0053502", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "FBgn0285970", "url": "https://flybase.org/reports/FBgn0285970", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "2768875", "url": "https://www.ncbi.nlm.nih.gov/gene/2768875", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2768879", "url": "https://www.ncbi.nlm.nih.gov/gene/2768879", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "318252", "url": "https://www.ncbi.nlm.nih.gov/gene/318252", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000629", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000629", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001075", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001075", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014824", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014824", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034904", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034904", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036498", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036498", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG32500", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG32500", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "dme:Dmel_CG32857", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG32857", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "dme:Dmel_CG33502", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG33502", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "AIMEHYM", "url": "https://omabrowser.org/oma/group/AIMEHYM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "168791at2759", "url": "http://www.orthodb.org/?query=168791at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11178", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11178", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11178:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11178:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01106", "url": "http://pfam.xfam.org/family/PF01106", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08712", "url": "http://pfam.xfam.org/family/PF08712", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8SY96", "url": "http://purl.obolibrary.org/obo/PR_Q8SY96", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_728443", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_728443", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q8SY96", "url": "https://www.uniprot.org/uniprot/Q8SY96", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8SY96-1", "url": "https://www.uniprot.org/uniprot/Q8SY96-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSKFLSQAALNTLRNTRLGSRQLVRSFKGISNTRNHRIPAHQESGCGHSVGCGLLELRMPVACRRSMFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPNGTTAHNSPLAKLLFRVEGVKGVFFGADFVTISKQEGAEWSLIKPEVFAVIMDFFASGLPVLNDAQPNADTEILEDDDETVMMIKELLDTRIRPTVQEDGGDIVFMGYEGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESVEQVFDEADRMIESEFERFEKNLKTLKQQEPSGGGPH", "length": 283, "header": "sp|Q8SY96-1|NFU1_DROME Isoform 1 of NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN= PE=2 SV=1 CANONICAL=Q8SY96-1" }, "isoforms": [ { "isoform_ac": "Q8SY96-1", "url": "", "sequence": { "sequence": "MSKFLSQAALNTLRNTRLGSRQLVRSFKGISNTRNHRIPAHQESGCGHSVGCGLLELRMPVACRRSMFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPNGTTAHNSPLAKLLFRVEGVKGVFFGADFVTISKQEGAEWSLIKPEVFAVIMDFFASGLPVLNDAQPNADTEILEDDDETVMMIKELLDTRIRPTVQEDGGDIVFMGYEGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESVEQVFDEADRMIESEFERFEKNLKTLKQQEPSGGGPH", "length": 283, "header": "sp|Q8SY96-1|NFU1_DROME Isoform 1 of NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN= PE=2 SV=1 CANONICAL=Q8SY96-1" }, "locus": { "chromosome": "X", "start_pos": 21623669, "end_pos": 21621695, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0077374", "url": "https://www.ensembl.org/id/FBtr0077374" }, { "database": "Ensembl Peptide", "id": "FBpp0077066", "url": "https://www.ensembl.org/id/FBpp0077066" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q8SY96", "url": "https://www.uniprot.org/uniprot/Q8SY96" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "A Drosophila full-length cDNA resource.", "journal": "Genome Biol.", "date": "2002", "authors": "Stapleton M, Carlson J, Brokstein P, Yu C, Champe M, George R, Guarin H, Kronmiller B, Pacleb J, Park S, Wan K, Rubin GM, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q8SY96", "url": "https://www.uniprot.org/uniprot/Q8SY96" } ], "reference": [ { "type": "PubMed", "id": "12537569", "url": "https://glygen.org/publication/PubMed/12537569" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q8SY96", "url": "https://www.uniprot.org/uniprot/Q8SY96" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] } ], "pathway": [ { "id": "dme:Dmel_CG32500", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG32500", "resource": "KEGG Pathway" }, { "id": "dme:Dmel_CG32857", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG32857", "resource": "KEGG Pathway" }, { "id": "dme:Dmel_CG33502", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG33502", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P32860-1", "protein_name": "NifU-like protein, mitochondrial", "gene_name": "NFU1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MFKSVAKLGKSPIFYLNSQRLIHIKTLTTPNENALKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVESLMIGDDFLTINKDRMVHWNSIKPEIIDLLTKQLAYGEDVISKEFHAVQEEEGEGGYKINMPKFELTEEDEEVSELIEELIDTRIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCSSSEVTLKYGIESMLKHYVDEVKEVIQIMDPEQEIALKEFDKLEKKLESSKNTSHEK", "length": 256 }, "evidence": [ { "id": "Q8SY96", "url": "https://omabrowser.org/oma/group/Q8SY96/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q9UMS0-1", "protein_name": "NFU1 iron-sulfur cluster scaffold homolog, mitochondrial", "gene_name": "NFU1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAATARRGWGAAAVAAGLRRRFCHMLKNPYTIKKQPLHQFVQRPLFPLPAAFYHPVRYMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDESDEKEANSP", "length": 254 }, "evidence": [ { "id": "Q8SY96", "url": "https://omabrowser.org/oma/group/Q8SY96/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "iron-sulfur cluster assembly", "id": "GO:0016226", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016226", "evidence": [ { "database": "UniProtKB", "id": "Q8SY96", "url": "https://www.uniprot.org/uniprot/Q8SY96" } ], "pmid": "" }, { "name": "protein maturation by iron-sulfur cluster transfer", "id": "GO:0097428", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097428", "evidence": [ { "database": "UniProtKB", "id": "Q8SY96", "url": "https://www.uniprot.org/uniprot/Q8SY96" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "iron ion binding", "id": "GO:0005506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005506", "evidence": [ { "database": "UniProtKB", "id": "Q8SY96", "url": "https://www.uniprot.org/uniprot/Q8SY96" } ], "pmid": "" }, { "name": "4 iron, 4 sulfur cluster binding", "id": "GO:0051539", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051539", "evidence": [ { "database": "UniProtKB", "id": "Q8SY96", "url": "https://www.uniprot.org/uniprot/Q8SY96" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q8SY96", "url": "https://www.uniprot.org/uniprot/Q8SY96" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 99, "end_pos": 101, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }