{
    "uniprot_canonical_ac": "Q8R2R9-1",
    "uniprot_ac": "Q8R2R9",
    "uniprot_id": "AP3M2_MOUSE",
    "mass": {
        "chemical_mass": 46916.0,
        "monoisotopic_mass": 46916.0
    },
    "refseq": {
        "ac": "NP_001116292",
        "name": "AP-3 complex subunit mu-2",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116292"
    },
    "gene_names": [
        {
            "name": "Ap3m2",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q8R2R9",
            "id": "Q8R2R9"
        },
        {
            "name": "5830445E16Rik; AP-3B",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116292",
            "id": "NP_001116292"
        },
        {
            "name": "Ap3m2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116292",
            "id": "NP_001116292"
        }
    ],
    "protein_names": [
        {
            "name": "AP-3 complex subunit mu-2",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q8R2R9"
        },
        {
            "name": "AP-3 complex subunit mu-2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116292",
            "id": "NP_001116292"
        },
        {
            "name": "Adaptor-related protein complex 3 subunit mu-2",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8R2R9"
        },
        {
            "name": "Clathrin assembly protein assembly protein complex 3 mu-2 medium chain",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8R2R9"
        },
        {
            "name": "Clathrin coat assembly protein AP47 homolog 2",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8R2R9"
        },
        {
            "name": "Clathrin coat-associated protein AP47 homolog 2",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8R2R9"
        },
        {
            "name": "Golgi adaptor AP-1 47 kDa protein homolog 2",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8R2R9"
        },
        {
            "name": "HA1 47 kDa subunit homolog 2",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8R2R9"
        },
        {
            "name": "Mu3B-adaptin",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8R2R9"
        },
        {
            "name": "P47B",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8R2R9"
        },
        {
            "name": "m3B; P47B; mu3B-adaptin; HA1 47 kDa subunit homolog 2; golgi adaptor AP-1 47 kDa protein homolog 2; clathrin coat assembly protein AP47 homolog 2; adapter-related protein complex 3 mu-2 subunit; clathrin coat-associated protein AP47 homolog 2; clathrin assembly protein assembly protein complex 1 medium chain homolog 2; adapter-related protein complex 3 subunit mu-2; clathrin assembly protein assembly protein complex 3 mu-2 medium chain; adaptor-related protein complex 3 subunit mu-2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116292",
            "id": "NP_001116292"
        },
        {
            "name": "m3B",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8R2R9"
        }
    ],
    "function": [
        {
            "annotation": "Component of the adaptor complexes which link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. Ap47 is a subunit of the plasma membrane adaptor (By similarity). In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8R2R9",
                    "url": "https://www.uniprot.org/uniprot/Q8R2R9#function"
                },
                {
                    "database": "PubMed",
                    "id": "21998198",
                    "url": "https://glygen.org/publication/PubMed/21998198"
                }
            ]
        },
        {
            "annotation": "We have demonstrated genetic and alcohol-induced regulation of Ap3m2 expression. Although sequence analysis revealed no polymorphisms in the Ap3m2-coding region that could account for all phenotypic differences, there are several upstream SNPs that could.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001116292",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116292"
                },
                {
                    "database": "PubMed",
                    "id": "24923803",
                    "url": "https://glygen.org/publication/PubMed/24923803"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8R2R9",
                    "url": "https://www.uniprot.org/uniprot/Q8R2R9"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Ap3m2",
            "url": "https://www.uniprot.org/uniprot/Q8R2R9",
            "locus": {
                "chromosome": "8",
                "start_pos": 23277370,
                "end_pos": 23295638,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000031539",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000031539"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000031539",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000031539",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "cd14837",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14837",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "64933",
            "url": "https://www.ncbi.nlm.nih.gov/gene/64933",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "Q8R2R9",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:Q8R2R9*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR001392",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001392",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR011012",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR011012",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR018240",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR018240",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR022775",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR022775",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR028565",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR028565",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036168",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036168",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:64933",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:64933",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "1929214",
            "url": "http://www.informatics.jax.org/marker/MGI:1929214",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "Q8R2R9",
            "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8R2R9",
            "database": "O-GlcNAc Database",
            "categories": [
                "Glycoproteomics"
            ]
        },
        {
            "id": "TEPNTID",
            "url": "https://omabrowser.org/oma/group/TEPNTID/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "831588at2759",
            "url": "http://www.orthodb.org/?query=831588at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10529",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10529",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10529:SF341",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10529:SF341",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00928",
            "url": "http://pfam.xfam.org/family/PF00928",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF01217",
            "url": "http://pfam.xfam.org/family/PF01217",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q8R2R9",
            "url": "http://purl.obolibrary.org/obo/PR_Q8R2R9",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_001116292",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116292",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8R2R9",
            "url": "https://www.uniprot.org/uniprot/Q8R2R9",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8R2R9-1",
            "url": "https://www.uniprot.org/uniprot/Q8R2R9-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVYRHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNGFPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVVEEIDAIIDKSGSTVTAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSFIPPDGNFRLLAYHVSAQNLVAIPVYVKHSISFRDSSSLGRFEITVGPKQTMGKTIEGVIVTSQMPKGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQKLPSLKGTMGLQVGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYKPFKGIKYMTKAGKFQVRT",
        "length": 418,
        "header": "sp|Q8R2R9-1|AP3M2_MOUSE Isoform 1 of AP-3 complex subunit mu-2  OS=Mus musculus OX=10090 GN=Ap3m2 PE=1 SV=1 CANONICAL=Q8R2R9-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q8R2R9-1",
            "url": "",
            "sequence": {
                "sequence": "MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVYRHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNGFPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVVEEIDAIIDKSGSTVTAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSFIPPDGNFRLLAYHVSAQNLVAIPVYVKHSISFRDSSSLGRFEITVGPKQTMGKTIEGVIVTSQMPKGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQKLPSLKGTMGLQVGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYKPFKGIKYMTKAGKFQVRT",
                "length": 418,
                "header": "sp|Q8R2R9-1|AP3M2_MOUSE Isoform 1 of AP-3 complex subunit mu-2  OS=Mus musculus OX=10090 GN=Ap3m2 PE=1 SV=1 CANONICAL=Q8R2R9-1"
            },
            "locus": {
                "chromosome": "8",
                "start_pos": 23294048,
                "end_pos": 23279372,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000210656",
                        "url": "https://www.ensembl.org/id/ENSMUST00000210656"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000147967",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000147967"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "G49108TO",
            "type": "O-linked",
            "subtype": "O-GlcNAcylation",
            "site_category": "reported_with_glycan",
            "site_seq": "",
            "relation": "attached",
            "comment": "O-GlcNAcylation",
            "evidence": [
                {
                    "id": "Q8R2R9",
                    "database": "O-GlcNAc Database",
                    "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8R2R9"
                },
                {
                    "id": "33300544",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/33300544"
                }
            ]
        }
    ],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "glycoprotein",
        "glycoprotein_reported_with_glycan"
    ],
    "publication": [
        {
            "title": "The schizophrenia susceptibility factor dysbindin and its associated complex sort cargoes from cell bodies to the synapse.",
            "journal": "Mol. Biol. Cell",
            "date": "2011",
            "authors": "Larimore J, Tornieri K, Ryder PV, Gokhale A, Zlatic SA, Craige B, Lee JD, Talbot K, Pare JF, Smith Y, Faundez V",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8R2R9",
                    "url": "https://www.uniprot.org/uniprot/Q8R2R9"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21998198",
                    "url": "https://glygen.org/publication/PubMed/21998198"
                }
            ]
        },
        {
            "title": "Identification of a QTL in Mus musculus for alcohol preference, withdrawal, and Ap3m2 expression using integrative functional genomics and precision genetics.",
            "journal": "Genetics",
            "date": "2014",
            "authors": "Bubier JA, Jay JJ, Baker CL, Bergeson SE, Ohno H, Metten P, Crabbe JC, Chesler EJ",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001116292",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116292"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24923803",
                    "url": "https://glygen.org/publication/PubMed/24923803"
                }
            ]
        },
        {
            "title": "O-GlcNAcylation regulates dopamine neuron function, survival and degeneration in Parkinson disease.",
            "journal": "Brain : a journal of neurology",
            "date": "2020",
            "authors": "Lee BE, Kim HY, Kim HJ, Jeong H, Kim BG, Lee HE, Lee J, Kim HB, Lee SE, Yang YR, Yi EC, Hanover JA, Myung K, Suh PG, Kwon T, Kim JI",
            "evidence": [
                {
                    "database": "O-GlcNAc Database",
                    "id": "Q8R2R9",
                    "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8R2R9"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "33300544",
                    "url": "https://glygen.org/publication/PubMed/33300544"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:64933",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:64933",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "P53677-1",
            "protein_name": "AP-3 complex subunit mu-2",
            "gene_name": "AP3M2",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVYRHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNGFPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIIDKSGSTITAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSFIPPDGNFRLLSYHVSAQNLVAIPVYVKHNISFRDSSSLGRFEITVGPKQTMGKTIEGVTVTSQMPKGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQKLPSLKGTMSLQAGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYKPFKGIKYMTKAGKFQVRT",
                "length": 418
            },
            "evidence": [
                {
                    "id": "45231616",
                    "url": "http://www.informatics.jax.org/homology/45231616",
                    "database": "MGI"
                },
                {
                    "id": "Q8R2R9",
                    "url": "https://omabrowser.org/oma/group/Q8R2R9/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "P53678-1",
            "protein_name": "AP-3 complex subunit mu-2",
            "gene_name": "Ap3m2",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MIHSLFLINSAGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVYRHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNGFPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVVEEIDAIIDKSGSTVTAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSFIPPDGNFRLLSYHVSAQNLVAIPVYVKHSISFRDSGSLGRFEITVGPKQTMGKTIEGVTVTSQMPKGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQKLPSLKGTMGLQVGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYKPFKGIKYMTKAGKFQVRT",
                "length": 418
            },
            "evidence": [
                {
                    "id": "45231616",
                    "url": "http://www.informatics.jax.org/homology/45231616",
                    "database": "MGI"
                },
                {
                    "id": "Q8R2R9",
                    "url": "https://omabrowser.org/oma/group/Q8R2R9/",
                    "database": "OMA"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 8,
                "go_terms": [
                    {
                        "name": "early endosome",
                        "id": "GO:0005769",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8R2R9",
                                "url": "https://www.uniprot.org/uniprot/Q8R2R9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "Golgi apparatus",
                        "id": "GO:0005794",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8R2R9",
                                "url": "https://www.uniprot.org/uniprot/Q8R2R9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytoplasmic vesicle membrane",
                        "id": "GO:0030659",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030659",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8R2R9",
                                "url": "https://www.uniprot.org/uniprot/Q8R2R9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytoplasmic vesicle",
                        "id": "GO:0031410",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8R2R9",
                                "url": "https://www.uniprot.org/uniprot/Q8R2R9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "AP-3 adaptor complex",
                        "id": "GO:0030123",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030123",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8R2R9",
                                "url": "https://www.uniprot.org/uniprot/Q8R2R9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "clathrin adaptor complex",
                        "id": "GO:0030131",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030131",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8R2R9",
                                "url": "https://www.uniprot.org/uniprot/Q8R2R9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "axon cytoplasm",
                        "id": "GO:1904115",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904115",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8R2R9",
                                "url": "https://www.uniprot.org/uniprot/Q8R2R9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "presynapse",
                        "id": "GO:0098793",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098793",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8R2R9",
                                "url": "https://www.uniprot.org/uniprot/Q8R2R9"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 8,
                "go_terms": [
                    {
                        "name": "intracellular protein transport",
                        "id": "GO:0006886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8R2R9",
                                "url": "https://www.uniprot.org/uniprot/Q8R2R9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "endocytosis",
                        "id": "GO:0006897",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006897",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8R2R9",
                                "url": "https://www.uniprot.org/uniprot/Q8R2R9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "anterograde axonal transport",
                        "id": "GO:0008089",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008089",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8R2R9",
                                "url": "https://www.uniprot.org/uniprot/Q8R2R9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "anterograde synaptic vesicle transport",
                        "id": "GO:0048490",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048490",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8R2R9",
                                "url": "https://www.uniprot.org/uniprot/Q8R2R9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "intracellular transport",
                        "id": "GO:0046907",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046907",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8R2R9",
                                "url": "https://www.uniprot.org/uniprot/Q8R2R9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "synaptic vesicle recycling",
                        "id": "GO:0036465",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036465",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8R2R9",
                                "url": "https://www.uniprot.org/uniprot/Q8R2R9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "synaptic vesicle coating",
                        "id": "GO:0016183",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016183",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8R2R9",
                                "url": "https://www.uniprot.org/uniprot/Q8R2R9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "clathrin-coated vesicle cargo loading, AP-3-mediated",
                        "id": "GO:0035654",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035654",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8R2R9",
                                "url": "https://www.uniprot.org/uniprot/Q8R2R9"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 320,
            "end_pos": 322,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 9,
            "end_pos": 11,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 1
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 1
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment"
            ]
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 3
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}