{ "uniprot_canonical_ac": "Q8R2B4-1", "uniprot_ac": "Q8R2B4", "uniprot_id": "Q8R2B4_MOUSE", "mass": { "chemical_mass": 36794.0, "monoisotopic_mass": 36794.0 }, "refseq": { "ac": "NP_997428", "name": "vomeronasal 1 receptor 179", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997428" }, "gene_names": [ { "name": "Vmn1r179", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8R2B4", "id": "Q8R2B4" }, { "name": "V1rd17", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997428", "id": "NP_997428" }, { "name": "V1rd17", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q8R2B4", "id": "Q8R2B4" }, { "name": "Vmn1r179", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997428", "id": "NP_997428" } ], "protein_names": [ { "name": "Vomeronasal type-1 receptor", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8R2B4" }, { "name": "vomeronasal 1 receptor 179", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997428", "id": "NP_997428" }, { "name": "vomeronasal 1 receptor, D17; vomernasal 1 receptor Vmn1r179", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997428", "id": "NP_997428" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8R2B4", "url": "https://www.uniprot.org/uniprot/Q8R2B4" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Vmn1r179", "url": "https://www.uniprot.org/uniprot/Q8R2B4", "locus": { "chromosome": "7", "start_pos": 23635670, "end_pos": 23626403, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000046924", "url": "https://www.ensembl.org/id/ENSMUSG00000046924" } ] } } ], "crossref": [ { "id": "404286", "url": "https://www.ncbi.nlm.nih.gov/gene/404286", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR004072", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004072", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:404286", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:404286", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "3033486", "url": "http://www.informatics.jax.org/marker/MGI:3033486", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "4791882at2759", "url": "http://www.orthodb.org/?query=4791882at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24062", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24062", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24062:SF51", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24062:SF51", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03402", "url": "http://pfam.xfam.org/family/PF03402", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_997428", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997428", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q8R2B4", "url": "https://www.uniprot.org/uniprot/Q8R2B4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8R2B4-1", "url": "https://www.uniprot.org/uniprot/Q8R2B4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSYLIITPVSAKALSMCTLDKSLKTTEEVALQIFLLCQFGVGTVANVFLFVHNFYPVLTGSQQSPRQVILSHMAVANILILFITIFPTNVMTFAPRNPPTDLKCKLEFFIRLVARSTNLCSTCVLSIYQFVTLVPVNRGKLILRASVPSLARYSCYSCWFFSVLNNIYIPIKVTGPQIADNNTDCRSKLFCFTFGYSRVIFFLRIAYDATFMSIMVWTSVSMVLLLHRHHHKMQHIFTTNRHYRGQAETRATSTILMLVVTFVSFYLLNFTCIIIQALVTDSHAFVRHWSEALVTGFPTISPLLLIFRKSKDPCSVFFRLLKS", "length": 323, "header": "tr|Q8R2B4-1|Q8R2B4_MOUSE Isoform 1 of Vomeronasal type-1 receptor OS=Mus musculus OX=10090 GN=Vmn1r179 PE=3 SV=1 CANONICAL=Q8R2B4-1" }, "isoforms": [ { "isoform_ac": "Q8R2B4-1", "url": "", "sequence": { "sequence": "MSYLIITPVSAKALSMCTLDKSLKTTEEVALQIFLLCQFGVGTVANVFLFVHNFYPVLTGSQQSPRQVILSHMAVANILILFITIFPTNVMTFAPRNPPTDLKCKLEFFIRLVARSTNLCSTCVLSIYQFVTLVPVNRGKLILRASVPSLARYSCYSCWFFSVLNNIYIPIKVTGPQIADNNTDCRSKLFCFTFGYSRVIFFLRIAYDATFMSIMVWTSVSMVLLLHRHHHKMQHIFTTNRHYRGQAETRATSTILMLVVTFVSFYLLNFTCIIIQALVTDSHAFVRHWSEALVTGFPTISPLLLIFRKSKDPCSVFFRLLKS", "length": 323, "header": "tr|Q8R2B4-1|Q8R2B4_MOUSE Isoform 1 of Vomeronasal type-1 receptor OS=Mus musculus OX=10090 GN=Vmn1r179 PE=3 SV=1 CANONICAL=Q8R2B4-1" }, "locus": { "chromosome": "7", "start_pos": 23628779, "end_pos": 23627811, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000049819.4", "url": "https://www.ensembl.org/id/ENSMUST00000049819.4" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000055372.4", "url": "https://www.ensembl.org/id/ENSMUSP00000055372.4" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Multiple new and isolated families within the mouse superfamily of V1r vomeronasal receptors.", "journal": "Nat. Neurosci.", "date": "2002", "authors": "Rodriguez I, Del Punta K, Rothman A, Ishii T, Mombaerts P", "evidence": [ { "database": "UniProtKB", "id": "Q8R2B4", "url": "https://www.uniprot.org/uniprot/Q8R2B4" } ], "reference": [ { "type": "PubMed", "id": "11802169", "url": "https://glygen.org/publication/PubMed/11802169" } ] } ], "pathway": [ { "id": "mmu:404286", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:404286", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q8R2B4", "url": "https://www.uniprot.org/uniprot/Q8R2B4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "response to pheromone", "id": "GO:0019236", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019236", "evidence": [ { "database": "UniProtKB", "id": "Q8R2B4", "url": "https://www.uniprot.org/uniprot/Q8R2B4" } ], "pmid": "" }, { "name": "sensory perception of chemical stimulus", "id": "GO:0007606", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007606", "evidence": [ { "database": "UniProtKB", "id": "Q8R2B4", "url": "https://www.uniprot.org/uniprot/Q8R2B4" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "pheromone receptor activity", "id": "GO:0016503", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016503", "evidence": [ { "database": "UniProtKB", "id": "Q8R2B4", "url": "https://www.uniprot.org/uniprot/Q8R2B4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 181, "end_pos": 183, "annotation": "n_glycosylation_sequon" }, { "start_pos": 269, "end_pos": 271, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }