{ "uniprot_canonical_ac": "Q8R1G1-1", "uniprot_ac": "Q8R1G1", "uniprot_id": "TASP1_MOUSE", "mass": { "chemical_mass": 44360.0, "monoisotopic_mass": 44360.0 }, "refseq": { "ac": "NP_001153113", "name": "threonine aspartase 1 isoform b", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153113" }, "gene_names": [ { "name": "Tasp1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8R1G1", "id": "Q8R1G1" }, { "name": "4930485D02Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153112", "id": "NP_001153112" }, { "name": "Tasp1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153112", "id": "NP_001153112" } ], "protein_names": [ { "name": "Threonine aspartase 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8R1G1" }, { "name": "3.4.25.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8R1G1" }, { "name": "Taspase-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8R1G1" }, { "name": "threonine aspartase 1 isoform a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153112", "id": "NP_001153112" }, { "name": "threonine aspartase 1 isoform b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153113", "id": "NP_001153113" }, { "name": "threonine aspartase 1; taspase-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153113", "id": "NP_001153113" } ], "function": [ { "annotation": "Protease responsible for KMT2A/MLL1 and KMT2D/MLL2 processing and activation (PubMed:16951254). Through substrate activation, it controls the expression of HOXA genes, and the expression of key cell cycle regulators including CCNA1, CCNB1, CCNE1 and CDKN2A (PubMed:16951254).", "evidence": [ { "database": "UniProtKB", "id": "Q8R1G1", "url": "https://www.uniprot.org/uniprot/Q8R1G1#function" }, { "database": "UniProtKB", "id": "Q9H6P5", "url": "https://www.uniprot.org/uniprot/Q9H6P5#function" }, { "database": "PubMed", "id": "16951254", "url": "https://glygen.org/publication/PubMed/16951254" } ] }, { "annotation": "TASP1, EPS15R, and PRPF3 expression were significantly induced in HCCs of transgenic EGF2B mice as was P2 promoter-driven HNF4alpha", "evidence": [ { "database": "RefSeq", "id": "NP_001153113", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153113" }, { "database": "PubMed", "id": "18395097", "url": "https://glygen.org/publication/PubMed/18395097" }, { "database": "RefSeq", "id": "NP_001153112", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153112" } ] }, { "annotation": "TFIIA is the principal TASP1 substrate that orchestrates craniofacial morphogenesis.", "evidence": [ { "database": "RefSeq", "id": "NP_001153113", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153113" }, { "database": "PubMed", "id": "25664857", "url": "https://glygen.org/publication/PubMed/25664857" }, { "database": "RefSeq", "id": "NP_001153112", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153112" } ] }, { "annotation": "Taspase1 deficiency disrupts the expression of cyclins and proliferation of HER2+ breast cancer cells.", "evidence": [ { "database": "RefSeq", "id": "NP_001153113", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153113" }, { "database": "PubMed", "id": "25267403", "url": "https://glygen.org/publication/PubMed/25267403" }, { "database": "RefSeq", "id": "NP_001153112", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153112" } ] }, { "annotation": "This paper describes the quintessential function of Taspase1 in orchestrating cell cycle progression.", "evidence": [ { "database": "RefSeq", "id": "NP_001153113", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153113" }, { "database": "PubMed", "id": "16951254", "url": "https://glygen.org/publication/PubMed/16951254" }, { "database": "RefSeq", "id": "NP_001153112", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153112" } ] }, { "annotation": "Upon loss of taspase1, MLL1 association with chromatin is markedly increased due to the stabilization of its unprocessed version, and this stabilization of the uncleaved MLL1 can result in the displacement of MLL chimeras from chromatin in leukemic cells", "evidence": [ { "database": "RefSeq", "id": "NP_001153113", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153113" }, { "database": "PubMed", "id": "30573454", "url": "https://glygen.org/publication/PubMed/30573454" }, { "database": "RefSeq", "id": "NP_001153112", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153112" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8R1G1", "url": "https://www.uniprot.org/uniprot/Q8R1G1" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Tasp1", "url": "https://www.uniprot.org/uniprot/Q8R1G1", "locus": { "chromosome": "2", "start_pos": 139675400, "end_pos": 139908725, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000039033", "url": "https://www.ensembl.org/id/ENSMUSG00000039033" } ] } } ], "crossref": [ { "id": "ENSMUSG00000039033", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000039033", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd04514", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04514", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "75812", "url": "https://www.ncbi.nlm.nih.gov/gene/75812", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000246", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000246", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029055", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029055", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037464", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037464", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:75812", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:75812", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1923062", "url": "http://www.informatics.jax.org/marker/MGI:1923062", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "TNSMIIG", "url": "https://omabrowser.org/oma/group/TNSMIIG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "6572at2759", "url": "http://www.orthodb.org/?query=6572at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10188", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10188", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10188:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10188:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01112", "url": "http://pfam.xfam.org/family/PF01112", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8R1G1", "url": "http://purl.obolibrary.org/obo/PR_Q8R1G1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9772755", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001153112", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153112", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q3UJT0", "url": "https://www.uniprot.org/uniprot/Q3UJT0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3UJT0-1", "url": "https://www.uniprot.org/uniprot/Q3UJT0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8R1G1", "url": "https://www.uniprot.org/uniprot/Q8R1G1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8R1G1-1", "url": "https://www.uniprot.org/uniprot/Q8R1G1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8R1G1-2", "url": "https://www.uniprot.org/uniprot/Q8R1G1-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MIMEKGMNSGEGLPSRSSQASAAKVTVKELETQQPCKEKRGGFVLVHAGAGYHSESKAKEYKHVCKRACQKAIEKLQAGALATDAVAAALVELEDSPFTNAGIGSNLNLLGEIECDASIMDGKSLNFGAVGALSGIKNPVSVAHRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIPSCPPSTMTTRFSLAAFKRNKRKLELAERVETDFIQLKRRRQSSAKENDSGTLDTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAQNPYSTAVSTSGCGEHLVRTILARECSHALQAEDAHQALLETMQNKFISSPFLACEDGVLGGVIVLRSCRCSSESDSSQDKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAIEGGVCRLESPVN", "length": 420, "header": "sp|Q8R1G1-1|TASP1_MOUSE Isoform 1 of Threonine aspartase 1 OS=Mus musculus OX=10090 GN=Tasp1 PE=2 SV=1 CANONICAL=Q8R1G1-1" }, "isoforms": [ { "isoform_ac": "Q3UJT0-1", "url": "", "sequence": { "sequence": "MIMEKGMNSGEGLPSRSSQASAAKVTVKELETQQPCKEKRGGFVLVHAGAGYHSESKAKEYKHVCKRACQKAIEKLQAGALATDAVAAALVELEDSPFTNAGIGSNLNLLGEIECDASIMDGKSLNFGAVGALSGIKNPVSVAHRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIPSCPPSTMTTRFSLAAFKRNKRKLELAERVETDFIQLKRRRQSSAKENDSGTLDTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAQNPYSTAVSTSGSPFLACEDGVLGGVIVLRSCRCSSESDSSQDKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAIEGGVCRLESPVN", "length": 383, "header": "tr|Q3UJT0-1|TASP1_MOUSE Computationally mapped isoform of Threonine aspartase 1 OS=Mus musculus OX=10090 GN=Tasp1 PE=2 SV=1 CANONICAL=Q8R1G1-1" }, "locus": { "chromosome": "2", "start_pos": 139899351, "end_pos": 139676278, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000099304.4", "url": "https://www.ensembl.org/id/ENSMUST00000099304.4" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000096907.4", "url": "https://www.ensembl.org/id/ENSMUSP00000096907.4" } ] } }, { "isoform_ac": "Q8R1G1-1", "url": "", "sequence": { "sequence": "MIMEKGMNSGEGLPSRSSQASAAKVTVKELETQQPCKEKRGGFVLVHAGAGYHSESKAKEYKHVCKRACQKAIEKLQAGALATDAVAAALVELEDSPFTNAGIGSNLNLLGEIECDASIMDGKSLNFGAVGALSGIKNPVSVAHRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIPSCPPSTMTTRFSLAAFKRNKRKLELAERVETDFIQLKRRRQSSAKENDSGTLDTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAQNPYSTAVSTSGCGEHLVRTILARECSHALQAEDAHQALLETMQNKFISSPFLACEDGVLGGVIVLRSCRCSSESDSSQDKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAIEGGVCRLESPVN", "length": 420, "header": "sp|Q8R1G1-1|TASP1_MOUSE Isoform 1 of Threonine aspartase 1 OS=Mus musculus OX=10090 GN=Tasp1 PE=2 SV=1 CANONICAL=Q8R1G1-1" }, "locus": { "chromosome": "2", "start_pos": 139899351, "end_pos": 139676278, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000046656", "url": "https://www.ensembl.org/id/ENSMUST00000046656" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000039546", "url": "https://www.ensembl.org/id/ENSMUSP00000039546" } ] } }, { "isoform_ac": "Q8R1G1-2", "url": "", "sequence": { "sequence": "MIMEKGMNSGEGLPSRSSQASAAKVTVKELETQQPCKEKRGGFVLVHAGAGYHSESKAKEYKHVCKRACQKAIEKLQAGALATDAVAAALVELEDSPFTNAGIGSNLNLLGEIECDASIMDGKSLNFGAVGALSGIKNPVSVAHRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIPSCPPSTMTTRFSLAAFKRNKRKLELAERVETDFIQLKRRRQSSAKVRRCLKNWLMHGRDVVDLLLEQYCPFEL", "length": 253, "header": "sp|Q8R1G1-2|TASP1_MOUSE Isoform 2 of Threonine aspartase 1 OS=Mus musculus OX=10090 GN=Tasp1 PE=2 SV=1 CANONICAL=Q8R1G1-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Proteolysis of MLL family proteins is essential for taspase1-orchestrated cell cycle progression.", "journal": "Genes Dev.", "date": "2006", "authors": "Takeda S, Chen DY, Westergard TD, Fisher JK, Rubens JA, Sasagawa S, Kan JT, Korsmeyer SJ, Cheng EH, Hsieh JJ", "evidence": [ { "database": "UniProtKB", "id": "Q8R1G1", "url": "https://www.uniprot.org/uniprot/Q8R1G1" }, { "database": "RefSeq", "id": "NP_001153112", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153112" }, { "database": "RefSeq", "id": "NP_001153113", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153113" } ], "reference": [ { "type": "PubMed", "id": "16951254", "url": "https://glygen.org/publication/PubMed/16951254" } ] }, { "title": "EPS15R, TASP1, and PRPF3 are novel disease candidate genes targeted by HNF4alpha splice variants in hepatocellular carcinomas.", "journal": "Gastroenterology", "date": "2008", "authors": "Niehof M, Borlak J", "evidence": [ { "database": "RefSeq", "id": "NP_001153113", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153113" }, { "database": "RefSeq", "id": "NP_001153112", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153112" } ], "reference": [ { "type": "PubMed", "id": "18395097", "url": "https://glygen.org/publication/PubMed/18395097" } ] }, { "title": "Taspase1 cleaves MLL1 to activate cyclin E for HER2/neu breast tumorigenesis.", "journal": "Cell research", "date": "2014", "authors": "Dong Y, Van Tine BA, Oyama T, Wang PI, Cheng EH, Hsieh JJ", "evidence": [ { "database": "RefSeq", "id": "NP_001153112", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153112" }, { "database": "RefSeq", "id": "NP_001153113", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153113" } ], "reference": [ { "type": "PubMed", "id": "25267403", "url": "https://glygen.org/publication/PubMed/25267403" } ] }, { "title": "Taspase1-dependent TFIIA cleavage coordinates head morphogenesis by limiting Cdkn2a locus transcription.", "journal": "The Journal of clinical investigation", "date": "2015", "authors": "Takeda S, Sasagawa S, Oyama T, Searleman AC, Westergard TD, Cheng EH, Hsieh JJ", "evidence": [ { "database": "RefSeq", "id": "NP_001153113", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153113" }, { "database": "RefSeq", "id": "NP_001153112", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153112" } ], "reference": [ { "type": "PubMed", "id": "25664857", "url": "https://glygen.org/publication/PubMed/25664857" } ] }, { "title": "Regulation of MLL/COMPASS stability through its proteolytic cleavage by taspase1 as a possible approach for clinical therapy of leukemia.", "journal": "Genes & development", "date": "2019", "authors": "Zhao Z, Wang L, Volk AG, Birch NW, Stoltz KL, Bartom ET, Marshall SA, Rendleman EJ, Nestler CM, Shilati J, Schiltz GE, Crispino JD, Shilatifard A", "evidence": [ { "database": "RefSeq", "id": "NP_001153113", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153113" }, { "database": "RefSeq", "id": "NP_001153112", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001153112" } ], "reference": [ { "type": "PubMed", "id": "30573454", "url": "https://glygen.org/publication/PubMed/30573454" } ] } ], "pathway": [ { "id": "mmu:75812", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:75812", "resource": "KEGG Pathway" }, { "id": "R-MMU-9772755", "name": "Formation of WDR5-containing histone-modifying complexes", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9772755", "resource": "Reactome", "description": "Formation of WDR5-containing histone-modifying complexes" } ], "orthologs": [ { "uniprot_canonical_ac": "A6HQL8-1", "protein_name": "Taspase, threonine aspartase 1", "gene_name": "Tasp1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MIMEKGMNSGEGLPSRSSQASAAKITVKELETQQPCKEKRGGFVLVHAGAGYHSESKAKEYKHVCKRACQKAIEKLQAGALATDAVMAALVELEDSPFTNAGVGSNLNLLGEIECDASIMDGKSLSFGAVGALSGIKNPVSVAHRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIPSCPPSTMTTRFSLAAFKRNKRKLELAERVETDFIQLKRRRQSSAKENDSGALDTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHNPYSTAVSTSGCGEHLVRTILARECSHALQAEDAHQALLETMQNKFISSPFLASEDGVLGGVIVLRSCRCPSESDPSQDKQTLLVEFLWSHSTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAIEGGVCRLESPVN", "length": 420 }, "evidence": [ { "id": "45235368", "url": "http://www.informatics.jax.org/homology/45235368", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9H6P5-1", "protein_name": "Threonine aspartase 1", "gene_name": "TASP1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTMEKGMSSGEGLPSRSSQVSAGKITAKELETKQSYKEKRGGFVLVHAGAGYHSESKAKEYKHVCKRACQKAIEKLQAGALATDAVTAALVELEDSPFTNAGMGSNLNLLGEIECDASIMDGKSLNFGAVGALSGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIPSCPPNIMTTRFSLAAFKRNKRKLELAERVDTDFMQLKKRRQSSEKENDSGTLDTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHNPYSTAVSTSGCGEHLVRTILARECSHALQAEDAHQALLETMQNKFISSPFLASEDGVLGGVIVLRSCRCSAEPDSSQNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAIEGGVCRLESPVN", "length": 420 }, "evidence": [ { "id": "45235368", "url": "http://www.informatics.jax.org/homology/45235368", "database": "MGI" }, { "id": "Q8R1G1", "url": "https://omabrowser.org/oma/group/Q8R1G1/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q8R1G1", "url": "https://www.uniprot.org/uniprot/Q8R1G1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "Q8R1G1", "url": "https://www.uniprot.org/uniprot/Q8R1G1" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "Q8R1G1", "url": "https://www.uniprot.org/uniprot/Q8R1G1" } ], "pmid": "" }, { "name": "protein maturation", "id": "GO:0051604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051604", "evidence": [ { "database": "UniProtKB", "id": "Q8R1G1", "url": "https://www.uniprot.org/uniprot/Q8R1G1" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q8R1G1", "url": "https://www.uniprot.org/uniprot/Q8R1G1" } ], "pmid": "" }, { "name": "asparaginase activity", "id": "GO:0004067", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004067", "evidence": [ { "database": "UniProtKB", "id": "Q8R1G1", "url": "https://www.uniprot.org/uniprot/Q8R1G1" } ], "pmid": "" }, { "name": "beta-aspartyl-peptidase activity", "id": "GO:0008798", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008798", "evidence": [ { "database": "UniProtKB", "id": "Q8R1G1", "url": "https://www.uniprot.org/uniprot/Q8R1G1" } ], "pmid": "" }, { "name": "threonine-type endopeptidase activity", "id": "GO:0004298", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004298", "evidence": [ { "database": "UniProtKB", "id": "Q8R1G1", "url": "https://www.uniprot.org/uniprot/Q8R1G1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 227, "end_pos": 229, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-MMU-9818574", "name": "TASP1 cleaves KMT2A", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8R1G1-1", "P55200-1" ], "evidence": [ { "id": "R-MMU-9818574", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9818574" } ] }, { "id": "R-MMU-9818635", "name": "Tasp1 cleaves Kmt2b", "equation": "", "summary": "In wild type mouse embryonic fibroblasts (MEFs) the two cleavage fragments of Kmt2b (Mll2) predicted based on the sequence conservation with Kmt2a (also known as Mll or Mll1) are detected. The cleavage does not occur in Tasp1 null MEFs and is rescued upon exogenous expression of recombinant Tasp1 (Takeda et al. 2006).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O08550-1", "Q8R1G1-1" ], "evidence": [ { "id": "R-MMU-9818635", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9818635" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "O08550", "gene_name": "Kmt2b", "activity": [ { "ec_number": "2.1.1.364", "activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "O08550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08550" } ] }, { "ec_number": "2.1.1.364", "activity": "", "evidence": [ { "id": "O08550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08550" } ] } ] }, { "uniprot_ac": "P55200", "gene_name": "Kmt2a", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "P55200", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55200" } ] }, { "ec_number": "2.1.1.364", "activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P55200", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55200" } ] }, { "ec_number": "2.1.1.364", "activity": "", "evidence": [ { "id": "P55200", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55200" } ] } ] }, { "uniprot_ac": "Q8R1G1", "gene_name": "Tasp1", "activity": [ { "ec_number": "3.4.25.-", "activity": "", "evidence": [ { "id": "Q8R1G1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R1G1" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }