{ "uniprot_canonical_ac": "Q8R000-1", "uniprot_ac": "Q8R000", "uniprot_id": "OSTA_MOUSE", "mass": { "chemical_mass": 37759.0, "monoisotopic_mass": 37759.0 }, "refseq": { "ac": "NP_666044", "name": "organic solute transporter subunit alpha", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666044" }, "gene_names": [ { "name": "Slc51a", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8R000", "id": "Q8R000" }, { "name": "D630035O19Rik; Osta; OSTalpha", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666044", "id": "NP_666044" }, { "name": "Osta", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q8R000", "id": "Q8R000" }, { "name": "Slc51a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666044", "id": "NP_666044" } ], "protein_names": [ { "name": "Organic solute transporter subunit alpha", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8R000" }, { "name": "OST-alpha; solute carrier family 51 subunit alpha; organic solute transporter alpha", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666044", "id": "NP_666044" }, { "name": "OST-alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8R000" }, { "name": "Solute carrier family 51 subunit alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8R000" }, { "name": "organic solute transporter subunit alpha", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666044", "id": "NP_666044" } ], "function": [ { "annotation": "Co-expression of mouse Ostalpha-Ostbeta, but not the individual subunits, stimulated Na(+)-independent bile acid uptake and the apical-to-basolateral transport of taurocholate", "evidence": [ { "database": "RefSeq", "id": "NP_666044", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666044" }, { "database": "PubMed", "id": "15563450", "url": "https://glygen.org/publication/PubMed/15563450" } ] }, { "annotation": "Data suggest that transport of bile acid taurocholate is retained when OstB (organic solute transporter beta subunit) is truncated to contain only the transmembrane domain with 15 additional residues on each side and co-expressed with intact OstA; shorter fragments of OstB are inactive. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_666044", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666044" }, { "database": "PubMed", "id": "28455390", "url": "https://glygen.org/publication/PubMed/28455390" } ] }, { "annotation": "Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood (PubMed:15563450, PubMed:16317684, PubMed:17650074, PubMed:18292224, PubMed:22535958). Efficiently transports the major species of bile acids (taurocholate) (PubMed:16317684, PubMed:17650074, PubMed:18292224, PubMed:22535958). Taurine conjugates are transported more efficiently across the basolateral membrane than glycine-conjugated bile acids (PubMed:16317684). Can also transport steroids such as estrone 3-sulfate and dehydroepiandrosterone 3-sulfate, therefore playing a role in the enterohepatic circulation of sterols (By similarity). Able to transport eicosanoids such as prostaglandin E2 (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000#function" }, { "database": "PubMed", "id": "18292224", "url": "https://glygen.org/publication/PubMed/18292224" }, { "database": "PubMed", "id": "16317684", "url": "https://glygen.org/publication/PubMed/16317684" }, { "database": "PubMed", "id": "17650074", "url": "https://glygen.org/publication/PubMed/17650074" }, { "database": "UniProtKB", "id": "Q90YM5", "url": "https://www.uniprot.org/uniprot/Q90YM5#function" }, { "database": "PubMed", "id": "15563450", "url": "https://glygen.org/publication/PubMed/15563450" }, { "database": "UniProtKB", "id": "Q86UW1", "url": "https://www.uniprot.org/uniprot/Q86UW1#function" }, { "database": "PubMed", "id": "22535958", "url": "https://glygen.org/publication/PubMed/22535958" } ] }, { "annotation": "In conclusion, we identified Ost-alpha/Ost-beta as a novel FXR target. Absent Ost-alpha/Ost-beta induction in CA-fed FXR(-/-) animals may contribute to increased liver injury in these animals.", "evidence": [ { "database": "RefSeq", "id": "NP_666044", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666044" }, { "database": "PubMed", "id": "16357057", "url": "https://glygen.org/publication/PubMed/16357057" } ] }, { "annotation": "OSTalpha and OSTbeta mRNA levels were induced in the adrenals and kidneys of wild-type, but not FXR-/-, mice", "evidence": [ { "database": "RefSeq", "id": "NP_666044", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666044" }, { "database": "PubMed", "id": "16251721", "url": "https://glygen.org/publication/PubMed/16251721" } ] }, { "annotation": "The selective localization of OSTalpha and OSTbeta to the basolateral plasma membrane of epithelial cells responsible for bile acid and sterol reabsorption.", "evidence": [ { "database": "RefSeq", "id": "NP_666044", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666044" }, { "database": "PubMed", "id": "16317684", "url": "https://glygen.org/publication/PubMed/16317684" } ] } ], "disease": [ { "disease_id": "DOID:0070221", "recommended_name": { "id": "DOID:0070221", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070221", "name": "progressive familial intrahepatic cholestasis", "description": "An intrahepatic cholestasis characterized by early onset of chronic unremitting cholestasis of hepatocellular origin that progresses to hepatic fibrosis, cirrhosis, and end-stage liver disease before adulthood." }, "synonyms": [ { "id": "DOID:0070221", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070221", "name": "PFIC; Byler disease", "description": "" }, { "id": "MONDO:0008892", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008892", "name": "progressive familial intrahepatic cholestasis type 1", "description": "PFIC1, a type of progressive familial intrahepathic cholestasis (PFIC), is an infantile hereditary disorder in bile formation that is hepatocellular in origin and associated with extrahepatic features." }, { "id": "MONDO:0008892", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008892", "name": "Byler disease", "description": "" }, { "id": "MONDO:0008892", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008892", "name": "FIC1 deficiency", "description": "" }, { "id": "MONDO:0008892", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008892", "name": "PFIC1", "description": "" }, { "id": "MONDO:0008892", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008892", "name": "cholestasis, progressive familial intrahepatic 1", "description": "" }, { "id": "MONDO:0008892", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008892", "name": "cholestasis, progressive familial intrahepatic, type 1", "description": "" }, { "id": "MONDO:0008892", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008892", "name": "Byler's disease", "description": "" }, { "id": "MONDO:0008892", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008892", "name": "cholestasis, fatal intrahepatic", "description": "" }, { "id": "MONDO:0008892", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008892", "name": "cholestasis, progressive familial intrahepatic, 1", "description": "" }, { "id": "MONDO:0008892", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008892", "name": "progressive familial intrahepatic cholestasis", "description": "" }, { "id": "MONDO:0008892", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008892", "name": "severe ATP8B1 deficiency", "description": "" }, { "id": "MIM:211600", "resource": "MIM", "url": "https://www.omim.org/entry/211600", "name": "Cholestasis, progressive familial intrahepatic, 1", "description": "Cholestasis, progressive familial intrahepatic, 1" } ], "evidence": [ { "id": "0070221", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0070221" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Slc51a", "url": "https://www.uniprot.org/uniprot/Q8R000", "locus": { "chromosome": "16", "start_pos": 32293322, "end_pos": 32306697, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000035699", "url": "https://www.ensembl.org/id/ENSMUSG00000035699" } ] } } ], "crossref": [ { "id": "ENSMUSG00000035699", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000035699", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CHEMBL2073723", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2073723", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "106407", "url": "https://www.ncbi.nlm.nih.gov/gene/106407", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR005178", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005178", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:106407", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:106407", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2146634", "url": "http://www.informatics.jax.org/marker/MGI:2146634", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "CLPMVIP", "url": "https://omabrowser.org/oma/group/CLPMVIP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5355208at2759", "url": "http://www.orthodb.org/?query=5355208at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23423", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23423", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23423:SF11", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23423:SF11", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03619", "url": "http://pfam.xfam.org/family/PF03619", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8R000", "url": "http://purl.obolibrary.org/obo/PR_Q8R000", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-159418", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-159418", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_666044", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666044", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "50984", "url": "https://www.rhea-db.org/rhea/50984", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71703", "url": "https://www.rhea-db.org/rhea/71703", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71835", "url": "https://www.rhea-db.org/rhea/71835", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71839", "url": "https://www.rhea-db.org/rhea/71839", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71843", "url": "https://www.rhea-db.org/rhea/71843", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71847", "url": "https://www.rhea-db.org/rhea/71847", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71851", "url": "https://www.rhea-db.org/rhea/71851", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71855", "url": "https://www.rhea-db.org/rhea/71855", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71859", "url": "https://www.rhea-db.org/rhea/71859", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71863", "url": "https://www.rhea-db.org/rhea/71863", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71867", "url": "https://www.rhea-db.org/rhea/71867", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A338P6E4", "url": "https://www.uniprot.org/uniprot/A0A338P6E4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A338P6E4-1", "url": "https://www.uniprot.org/uniprot/A0A338P6E4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8R000-1", "url": "https://www.uniprot.org/uniprot/Q8R000-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEPGRTHIKLDPRYTAELLELLETNYSISPACFSHPPTAAQLLRALGPVDIALTIILTFLTTGSVAIFLEDAVYLYKNTLCPIKKRTLIWSSSAPTVVSVFCCFGLWIPRALTLVEMAITSFYAVCFYLLMMVMVEGFGGKKAVLRTLKDTPMRVHTGPCCCCCPCCPPLILTRKKLQLLLLGPFQYAFFKITLSIVGLFLIPDGIYDPGEISEKSAALWINNLLAVSTLLALWSLAILFRQAKMHLGEQNMGSKFALFQVLVILTALQPAIFSILANSGQIACSPPYSSKIRSQVMNCHMLILETFLMTVLTRMYYRRKDDKVGYEACSLPDLDSALKA", "length": 340, "header": "sp|Q8R000-1|OSTA_MOUSE Isoform 1 of Organic solute transporter subunit alpha OS=Mus musculus OX=10090 GN=Slc51a PE=1 SV=1 CANONICAL=Q8R000-1" }, "isoforms": [ { "isoform_ac": "A0A338P6E4-1", "url": "", "sequence": { "sequence": "MEPGRTHIKLDPRYTAELLELLETNYSISPACFSHPPTAAQLLRALGPVDIALTIILTFLTTGSVAIFLEDAVYLYKNTLCPIKKRTLIWSSSAPTVLCRMLLPADDGHGGRLWWEESSTEDTEGHPDEGAHGSLLLLLSLLPTSHTYQKEAAAAPAGPFPVRLLQDNAEHSGPVPHP", "length": 178, "header": "tr|A0A338P6E4-1|A0A338P6E4_MOUSE Computationally mapped isoform of Solute carrier family 51, alpha subunit OS=Mus musculus OX=10090 GN=Slc51a PE=4 SV=1 CANONICAL=Q8R000-1" }, "locus": { "chromosome": "16", "start_pos": 32306340, "end_pos": 32296391, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000231690.2", "url": "https://www.ensembl.org/id/ENSMUST00000231690.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000155959.2", "url": "https://www.ensembl.org/id/ENSMUSP00000155959.2" } ] } }, { "isoform_ac": "Q8R000-1", "url": "", "sequence": { "sequence": "MEPGRTHIKLDPRYTAELLELLETNYSISPACFSHPPTAAQLLRALGPVDIALTIILTFLTTGSVAIFLEDAVYLYKNTLCPIKKRTLIWSSSAPTVVSVFCCFGLWIPRALTLVEMAITSFYAVCFYLLMMVMVEGFGGKKAVLRTLKDTPMRVHTGPCCCCCPCCPPLILTRKKLQLLLLGPFQYAFFKITLSIVGLFLIPDGIYDPGEISEKSAALWINNLLAVSTLLALWSLAILFRQAKMHLGEQNMGSKFALFQVLVILTALQPAIFSILANSGQIACSPPYSSKIRSQVMNCHMLILETFLMTVLTRMYYRRKDDKVGYEACSLPDLDSALKA", "length": 340, "header": "sp|Q8R000-1|OSTA_MOUSE Isoform 1 of Organic solute transporter subunit alpha OS=Mus musculus OX=10090 GN=Slc51a PE=1 SV=1 CANONICAL=Q8R000-1" }, "locus": { "chromosome": "16", "start_pos": 32306340, "end_pos": 32294563, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000042042", "url": "https://www.ensembl.org/id/ENSMUST00000042042" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000046286", "url": "https://www.ensembl.org/id/ENSMUSP00000046286" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 25, "start_aa": "Asn", "end_pos": 25, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn25", "evidence": [ { "id": "Q8R000", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R000#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 330, "end_pos": 330, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q8R000", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8R000" } ], "site_lbl": "Ser330" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "The heteromeric organic solute transporter alpha-beta, Ostalpha-Ostbeta, is an ileal basolateral bile acid transporter.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Dawson PA, Hubbert M, Haywood J, Craddock AL, Zerangue N, Christian WV, Ballatori N", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" }, { "database": "RefSeq", "id": "NP_666044", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666044" } ], "reference": [ { "type": "PubMed", "id": "15563450", "url": "https://glygen.org/publication/PubMed/15563450" } ] }, { "title": "FXR regulates organic solute transporters alpha and beta in the adrenal gland, kidney, and intestine.", "journal": "Journal of lipid research", "date": "2006", "authors": "Lee H, Zhang Y, Lee FY, Nelson SF, Gonzalez FJ, Edwards PA", "evidence": [ { "database": "RefSeq", "id": "NP_666044", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666044" } ], "reference": [ { "type": "PubMed", "id": "16251721", "url": "https://glygen.org/publication/PubMed/16251721" } ] }, { "title": "OSTalpha-OSTbeta: a major basolateral bile acid and steroid transporter in human intestinal, renal, and biliary epithelia.", "journal": "Hepatology", "date": "2005", "authors": "Ballatori N, Christian WV, Lee JY, Dawson PA, Soroka CJ, Boyer JL, Madejczyk MS, Li N", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" }, { "database": "RefSeq", "id": "NP_666044", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666044" } ], "reference": [ { "type": "PubMed", "id": "16317684", "url": "https://glygen.org/publication/PubMed/16317684" } ] }, { "title": "Coordinated induction of bile acid detoxification and alternative elimination in mice: role of FXR-regulated organic solute transporter-alpha/beta in the adaptive response to bile acids.", "journal": "American journal of physiology. Gastrointestinal and liver physiology", "date": "2006", "authors": "Zollner G, Wagner M, Moustafa T, Fickert P, Silbert D, Gumhold J, Fuchsbichler A, Halilbasic E, Denk H, Marschall HU, Trauner M", "evidence": [ { "database": "RefSeq", "id": "NP_666044", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666044" } ], "reference": [ { "type": "PubMed", "id": "16357057", "url": "https://glygen.org/publication/PubMed/16357057" } ] }, { "title": "Regulation of the mouse organic solute transporter alpha-beta, Ostalpha-Ostbeta, by bile acids.", "journal": "Am. J. Physiol.", "date": "2006", "authors": "Chen F., Dawson P.A., Shneider B.L., Rao A., Frankenberg T., Haywood J.", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" } ], "reference": [ { "type": "PubMed", "id": "16357058", "url": "https://glygen.org/publication/PubMed/16357058" } ] }, { "title": "Mrp4-/- mice have an impaired cytoprotective response in obstructive cholestasis.", "journal": "Hepatology", "date": "2006", "authors": "Schuetz J.D., Adachi M., Boyer J.L., Soroka C.J., Cai S.Y., Hagey L., Harry K., Mennone A.", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" } ], "reference": [ { "type": "PubMed", "id": "16628672", "url": "https://glygen.org/publication/PubMed/16628672" } ] }, { "title": "Heterodimerization, trafficking and membrane topology of the two proteins, Ost alpha and Ost beta, that constitute the organic solute and steroid transporter.", "journal": "Biochem. J.", "date": "2007", "authors": "Li N, Cui Z, Fang F, Lee JY, Ballatori N", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" } ], "reference": [ { "type": "PubMed", "id": "17650074", "url": "https://glygen.org/publication/PubMed/17650074" } ] }, { "title": "The organic solute transporter alpha-beta, Ostalpha-Ostbeta, is essential for intestinal bile acid transport and homeostasis.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2008", "authors": "Kruh G.D., Belinsky M.G., Dawson P.A., Rao A., Craddock A.L., Haywood J.", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" } ], "reference": [ { "type": "PubMed", "id": "18292224", "url": "https://glygen.org/publication/PubMed/18292224" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" }, { "database": "iPTMnet", "id": "Q8R000", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8R000" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "beta-Subunit of the Ostalpha-Ostbeta organic solute transporter is required not only for heterodimerization and trafficking but also for function.", "journal": "J. Biol. Chem.", "date": "2012", "authors": "Christian WV, Li N, Hinkle PM, Ballatori N", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" } ], "reference": [ { "type": "PubMed", "id": "22535958", "url": "https://glygen.org/publication/PubMed/22535958" } ] }, { "title": "Global functions of extracellular, transmembrane and cytoplasmic domains of organic solute transporter beta-subunit.", "journal": "The Biochemical journal", "date": "2017", "authors": "Christian WV, Hinkle PM", "evidence": [ { "database": "RefSeq", "id": "NP_666044", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666044" } ], "reference": [ { "type": "PubMed", "id": "28455390", "url": "https://glygen.org/publication/PubMed/28455390" } ] } ], "pathway": [ { "id": "mmu:106407", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:106407", "resource": "KEGG Pathway" }, { "id": "R-MMU-159418", "name": "Recycling of bile acids and salts", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-159418", "resource": "Reactome", "description": "Recycling of bile acids and salts" } ], "orthologs": [ { "uniprot_canonical_ac": "D4AC81-1", "protein_name": "Solute carrier family 51 subunit alpha", "gene_name": "Slc51a", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEPGRTHIKLDPRYTADLLELLETNYSISPACFSHPPTAAQLLRELGSVEIALTIILTFFTIGSVAIFLEDAIYLYKNTLCPIKKRTLIWSSSAPTVVSVFCCFGLWIPRALTLVEMAITSFYAVCFYLLMMVMVEGFGGKEAVLRTLKDTPMRVHTGPCCCCCPCCPPLILTRKKLQLLMLGPFQYAFFKIVMSIVGLFLIPDGIYDPAEISEKSAALWISNFLAVSTLLALWSLAILFRQAKLHLGEQNMGSKFALFQVLVILTALQPSIFSILANSGQIACSPPYSSKIRSQVMNCHMLILETFLLTVLTRMYYRKKDNKVGYEACLPPDLDSTLKA", "length": 340 }, "evidence": [ { "id": "45233094", "url": "http://www.informatics.jax.org/homology/45233094", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q86UW1-1", "protein_name": "Organic solute transporter subunit alpha", "gene_name": "SLC51A", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEPGRTQIKLDPRYTADLLEVLKTNYGIPSACFSQPPTAAQLLRALGPVELALTSILTLLALGSIAIFLEDAVYLYKNTLCPIKRRTLLWKSSAPTVVSVLCCFGLWIPRSLVLVEMTITSFYAVCFYLLMLVMVEGFGGKEAVLRTLRDTPMMVHTGPCCCCCPCCPRLLLTRKKLQLLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVSTLLALWTLGIISRQARLHLGEQNMGAKFALFQVLLILTALQPSIFSVLANGGQIACSPPYSSKTRSQVMNCHLLILETFLMTVLTRMYYRRKDHKVGYETFSSPDLDLNLKA", "length": 340 }, "evidence": [ { "id": "45233094", "url": "http://www.informatics.jax.org/homology/45233094", "database": "MGI" }, { "id": "Q8R000", "url": "https://omabrowser.org/oma/group/Q8R000/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9VVV2-1", "protein_name": "Organic solute transporter alpha-like protein", "gene_name": "", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MNASENYFTMDPTENISQVLDQNRNNTNSLRTHPTVEEYYENMTAFLSLAIFIASLLTILNISIFATTVSRLRRHLDKPLLGPSIMMVGLYPIISVAALVTILVPYSWFICHTVMHVMFMVGGPVFRTLLFRYVGSEQNYVKETAGEAVQLNTPPCCCCCLCLPMVIPTKAKLCISRYMVWQMPFWQGSIMLVMNILYYRDIQLYRQVMFFFIPFIVCSIVLGAWSLQITVRMITKVRGDYQLRKKMFCLQLVVMLCKLQYLVLYDQLDGIKMGGEYPINHTVYKQTIINILILVEMVLVSMMVQSAYRTPVQVQIDEVNKEKEVTRI", "length": 328 }, "evidence": [ { "id": "Q8R000", "url": "https://omabrowser.org/oma/group/Q8R000/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "organic substance transport", "id": "GO:0071702", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071702", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" } ], "pmid": "" }, { "name": "bile acid and bile salt transport", "id": "GO:0015721", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015721", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" } ], "pmid": "" }, { "name": "bile acid secretion", "id": "GO:0032782", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032782", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" } ], "pmid": "" }, { "name": "basolateral plasma membrane", "id": "GO:0016323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016323", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "transmembrane transporter activity", "id": "GO:0022857", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022857", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" } ], "pmid": "" }, { "name": "bile acid transmembrane transporter activity", "id": "GO:0015125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015125", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 25, "end_pos": 27, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "Q8R000", "url": "https://www.uniprot.org/uniprot/Q8R000" }, { "database": "PubMed", "id": "15563450", "url": "https://glygen.org/publication/PubMed/15563450" } ] } ], "interactions": [], "reactions": [ { "id": "50984", "name": "", "equation": "prostaglandin E2(out) = prostaglandin E2(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "50984", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/50984" } ] }, { "id": "71703", "name": "", "equation": "taurocholate(out) = taurocholate(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71703", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71703" } ] }, { "id": "71835", "name": "", "equation": "estrone 3-sulfate(out) = estrone 3-sulfate(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71835", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71835" } ] }, { "id": "71839", "name": "", "equation": "dehydroepiandrosterone 3-sulfate(out) = dehydroepiandrosterone 3-sulfate(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71839", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71839" } ] }, { "id": "71843", "name": "", "equation": "tauroursodeoxycholate(out) = tauroursodeoxycholate(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71843", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71843" } ] }, { "id": "71847", "name": "", "equation": "glycoursodeoxycholate(out) = glycoursodeoxycholate(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71847", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71847" } ] }, { "id": "71851", "name": "", "equation": "glycocholate(out) = glycocholate(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71851", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71851" } ] }, { "id": "71855", "name": "", "equation": "taurochenodeoxycholate(out) = taurochenodeoxycholate(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71855", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71855" } ] }, { "id": "71859", "name": "", "equation": "glycochenodeoxycholate(out) = glycochenodeoxycholate(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71859", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71859" } ] }, { "id": "71863", "name": "", "equation": "taurodeoxycholate(out) = taurodeoxycholate(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71863", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71863" } ] }, { "id": "71867", "name": "", "equation": "glycodeoxycholate(out) = glycodeoxycholate(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71867", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71867" } ] } ], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }