{ "uniprot_canonical_ac": "Q8N7P3-1", "uniprot_ac": "Q8N7P3", "uniprot_id": "CLD22_HUMAN", "mass": { "chemical_mass": 24509.0, "monoisotopic_mass": 24509.0 }, "refseq": { "ac": "NP_001104789", "name": "claudin-22", "summary": "This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is intronless and overlaps the 3' UTR of the WWC2 gene (GeneID: 80014) on the opposite strand. [provided by RefSeq, Aug 2010].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001104789" }, "gene_names": [ { "name": "CLDN22", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8N7P3", "id": "Q8N7P3" }, { "name": "CLDN21", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001104789", "id": "NP_001104789" }, { "name": "CLDN22", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001104789", "id": "NP_001104789" } ], "protein_names": [ { "name": "Claudin-22", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8N7P3" }, { "name": "claudin-22", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001104789", "id": "NP_001104789" } ], "function": [ { "annotation": "CLDN21, clustered with CLDN22 at human chromosome 4q35.1, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.", "evidence": [ { "database": "RefSeq", "id": "NP_001104789", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001104789" }, { "database": "PubMed", "id": "12736707", "url": "https://glygen.org/publication/PubMed/12736707" } ] }, { "annotation": "Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8N7P3", "url": "https://www.uniprot.org/uniprot/Q8N7P3#function" } ] }, { "annotation": "This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is intronless and overlaps the 3' UTR of the WWC2 gene (GeneID: 80014) on the opposite strand. [provided by RefSeq, Aug 2010].", "evidence": [ { "database": "RefSeq", "id": "NP_001104789", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001104789" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "63.87", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000177300", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177300" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "16.41", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000177300", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177300" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000177300", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177300" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "16.94", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000177300", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177300" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "24.21", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000177300", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177300" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "40.33", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000177300", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177300" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "16.88", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000177300", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177300" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "44.06", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000177300", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177300" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "36.99", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000177300", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177300" } ] } ], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N7P3", "url": "https://www.uniprot.org/uniprot/Q8N7P3" } ], "common_name": "Human" } ], "gene": [ { "name": "CLDN22", "url": "https://www.uniprot.org/uniprot/Q8N7P3", "locus": { "chromosome": "4", "start_pos": 183318100, "end_pos": 183320276, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000177300", "url": "https://www.ensembl.org/id/ENSG00000177300" } ] } } ], "crossref": [ { "id": "ENSG00000177300", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177300", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CLDN22", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CLDN22", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "53842", "url": "https://www.ncbi.nlm.nih.gov/gene/53842", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2044", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=2044", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "Q8N7P3", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q8N7P3*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR004031", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004031", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006187", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006187", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017974", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017974", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:53842", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:53842", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NX_Q8N7P3", "url": "https://www.nextprot.org/entry/NX_Q8N7P3", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "QTQDHHQ", "url": "https://omabrowser.org/oma/group/QTQDHHQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4058939at2759", "url": "http://www.orthodb.org/?query=4058939at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12002", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12002", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12002:SF84", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12002:SF84", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00822", "url": "http://pfam.xfam.org/family/PF00822", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "Q8N7P3", "url": "https://pharos.nih.gov/targets/Q8N7P3", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_Q8N7P3", "url": "http://purl.obolibrary.org/obo/PR_Q8N7P3", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-420029", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420029", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001104789", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001104789", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q8N7P3", "url": "https://www.uniprot.org/uniprot/Q8N7P3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8N7P3-1", "url": "https://www.uniprot.org/uniprot/Q8N7P3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALVFRTVAQLAGVSLSLLGWVLSCLTNYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEVGMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGESQRDLKRRLLILGGILSWASGVTALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGGCLLHCAACSSHAPLASGHYAVAQTQDHHQELETRNTNLKH", "length": 220, "header": "sp|Q8N7P3-1|CLD22_HUMAN Isoform 1 of Claudin-22 OS=Homo sapiens OX=9606 GN=CLDN22 PE=1 SV=3 CANONICAL=Q8N7P3-1" }, "isoforms": [ { "isoform_ac": "Q8N7P3-1", "url": "", "sequence": { "sequence": "MALVFRTVAQLAGVSLSLLGWVLSCLTNYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEVGMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGESQRDLKRRLLILGGILSWASGVTALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGGCLLHCAACSSHAPLASGHYAVAQTQDHHQELETRNTNLKH", "length": 220, "header": "sp|Q8N7P3-1|CLD22_HUMAN Isoform 1 of Claudin-22 OS=Homo sapiens OX=9606 GN=CLDN22 PE=1 SV=3 CANONICAL=Q8N7P3-1" }, "locus": { "chromosome": "4", "start_pos": 183320218, "end_pos": 183319559, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000323319.7", "url": "https://www.ensembl.org/id/ENST00000323319.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000318113.5", "url": "https://www.ensembl.org/id/ENSP00000318113.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The cell polarity protein ASIP/PAR-3 directly associates with junctional adhesion molecule (JAM).", "journal": "The EMBO journal", "date": "2001", "authors": "Ebnet K, Suzuki A, Horikoshi Y, Hirose T, Meyer Zu Brickwedde MK, Ohno S, Vestweber D", "evidence": [ { "database": "Reactome", "id": "R-HSA-420029", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420029" } ], "reference": [ { "type": "PubMed", "id": "11447115", "url": "https://glygen.org/publication/PubMed/11447115" } ] }, { "title": "hINADl/PATJ, a homolog of discs lost, interacts with crumbs and localizes to tight junctions in human epithelial cells.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Lemmers C, Medina E, Delgrossi MH, Michel D, Arsanto JP, Le Bivic A", "evidence": [ { "database": "Reactome", "id": "R-HSA-420029", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420029" } ], "reference": [ { "type": "PubMed", "id": "11964389", "url": "https://glygen.org/publication/PubMed/11964389" } ] }, { "title": "CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family.", "journal": "International journal of molecular medicine", "date": "2003", "authors": "Katoh M, Katoh M", "evidence": [ { "database": "RefSeq", "id": "NP_001104789", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001104789" } ], "reference": [ { "type": "PubMed", "id": "12736707", "url": "https://glygen.org/publication/PubMed/12736707" } ] }, { "title": "The junctional adhesion molecule (JAM) family members JAM-2 and JAM-3 associate with the cell polarity protein PAR-3: a possible role for JAMs in endothelial cell polarity.", "journal": "Journal of cell science", "date": "2003", "authors": "Ebnet K, Aurrand-Lions M, Kuhn A, Kiefer F, Butz S, Zander K, Meyer zu Brickwedde MK, Suzuki A, Imhof BA, Vestweber D", "evidence": [ { "database": "Reactome", "id": "R-HSA-420029", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420029" } ], "reference": [ { "type": "PubMed", "id": "12953056", "url": "https://glygen.org/publication/PubMed/12953056" } ] }, { "title": "PATJ connects and stabilizes apical and lateral components of tight junctions in human intestinal cells.", "journal": "Journal of cell science", "date": "2005", "authors": "Michel D, Arsanto JP, Massey-Harroche D, Beclin C, Wijnholds J, Le Bivic A", "evidence": [ { "database": "Reactome", "id": "R-HSA-420029", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420029" } ], "reference": [ { "type": "PubMed", "id": "16129888", "url": "https://glygen.org/publication/PubMed/16129888" } ] } ], "pathway": [ { "id": "hsa:53842", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:53842", "resource": "KEGG Pathway" }, { "id": "R-HSA-420029", "name": "Tight junction interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420029", "resource": "Reactome", "description": "Tight junction interactions" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZEF2-1", "protein_name": "Claudin", "gene_name": "Cldn22", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGLVFRTATQSAALLLSLLGWVLSCLTNYLPHWKNLNLELNEMENWTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQISRILMSLSNGLGLLGLLASGCGLDCLRLGETRKGLKRRLLILGGTLLWTSGVMVLVPVSWVAHMTVQEFWDETVPEIVPRWEFGEALFLGWFAGFCLVLGGCVLHCAACWRPAPPASGHYAVAGLGDHQQHLELKQANPEV", "length": 220 }, "evidence": [ { "id": "45239328", "url": "http://www.informatics.jax.org/homology/45239328", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9D7U6-1", "protein_name": "Claudin-22", "gene_name": "Cldn22", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGLVFRTATQAAALLLSLLGWVLSCLTNYLPHWKNLNLELNEMENWTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQVSRVLMSLCNGLGLLGLLASGCGLDCLRLGETQEGLKKRLLTLGGTLLWTSGVMVLVPVSWVAHKTVREFWDETMPEIVPRWEFGEALFLGWFAGFCLVLGGCVLHCAACWSPAPAASSHYAVAGPRDHQQHLELKQANPEI", "length": 220 }, "evidence": [ { "id": "45239328", "url": "http://www.informatics.jax.org/homology/45239328", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q8N7P3", "url": "https://www.uniprot.org/uniprot/Q8N7P3" } ], "pmid": "" }, { "name": "bicellular tight junction", "id": "GO:0005923", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005923", "evidence": [ { "database": "UniProtKB", "id": "Q8N7P3", "url": "https://www.uniprot.org/uniprot/Q8N7P3" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "Q8N7P3", "url": "https://www.uniprot.org/uniprot/Q8N7P3" } ], "pmid": "" }, { "name": "bicellular tight junction assembly", "id": "GO:0070830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070830", "evidence": [ { "database": "UniProtKB", "id": "Q8N7P3", "url": "https://www.uniprot.org/uniprot/Q8N7P3" } ], "pmid": "" }, { "name": "calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules", "id": "GO:0016338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016338", "evidence": [ { "database": "UniProtKB", "id": "Q8N7P3", "url": "https://www.uniprot.org/uniprot/Q8N7P3" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q8N7P3", "url": "https://www.uniprot.org/uniprot/Q8N7P3" } ], "pmid": "" }, { "name": "structural molecule activity", "id": "GO:0005198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005198", "evidence": [ { "database": "UniProtKB", "id": "Q8N7P3", "url": "https://www.uniprot.org/uniprot/Q8N7P3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 45, "end_pos": 47, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }