{ "uniprot_canonical_ac": "Q8N0T1-1", "uniprot_ac": "Q8N0T1", "uniprot_id": "RBIS_HUMAN", "mass": { "chemical_mass": 11456.0, "monoisotopic_mass": 11456.0 }, "refseq": { "ac": "NP_001280249", "name": "ribosomal biogenesis factor isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001280249" }, "gene_names": [ { "name": "RBIS", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8N0T1", "id": "Q8N0T1" }, { "name": "C8orf59", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093140", "id": "NP_001093140" }, { "name": "C8orf59", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q8N0T1", "id": "Q8N0T1" }, { "name": "RBIS", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093140", "id": "NP_001093140" } ], "protein_names": [ { "name": "Ribosomal biogenesis factor", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8N0T1" }, { "name": "ribosomal biogenesis factor isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093140", "id": "NP_001093140" }, { "name": "ribosomal biogenesis factor isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001280249", "id": "NP_001280249" }, { "name": "uncharacterized protein C8orf59; ribosome biogenesis factor identified in screen", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001280249", "id": "NP_001280249" } ], "function": [ { "annotation": "Trans-acting factor in ribosome biogenesis required for efficient 40S and 60S subunit production.", "evidence": [ { "database": "UniProtKB", "id": "Q8N0T1", "url": "https://www.uniprot.org/uniprot/Q8N0T1#function" }, { "database": "PubMed", "id": "26711351", "url": "https://glygen.org/publication/PubMed/26711351" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N0T1", "url": "https://www.uniprot.org/uniprot/Q8N0T1" } ], "common_name": "Human" } ], "gene": [ { "name": "RBIS", "url": "https://www.uniprot.org/uniprot/Q8N0T1", "locus": { "chromosome": "8", "start_pos": 85214048, "end_pos": 85220421, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000176731", "url": "https://www.ensembl.org/id/ENSG00000176731" } ] } } ], "crossref": [ { "id": "ENSG00000176731", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000176731", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "RBIS", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=RBIS", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "401466", "url": "https://www.ncbi.nlm.nih.gov/gene/401466", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "32235", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=32235", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "Q8N0T1", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q8N0T1*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR031389", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031389", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:401466", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:401466", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NX_Q8N0T1", "url": "https://www.nextprot.org/entry/NX_Q8N0T1", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "Q8N0T1", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8N0T1", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "AMKNEKV", "url": "https://omabrowser.org/oma/group/AMKNEKV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5083391at2759", "url": "http://www.orthodb.org/?query=5083391at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR35544", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR35544", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR35544:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR35544:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15679", "url": "http://pfam.xfam.org/family/PF15679", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "Q8N0T1", "url": "https://pharos.nih.gov/targets/Q8N0T1", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_Q8N0T1", "url": "http://purl.obolibrary.org/obo/PR_Q8N0T1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001093140", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093140", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A087WWE7", "url": "https://www.uniprot.org/uniprot/A0A087WWE7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WWE7-1", "url": "https://www.uniprot.org/uniprot/A0A087WWE7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RGR5", "url": "https://www.uniprot.org/uniprot/E5RGR5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RGR5-1", "url": "https://www.uniprot.org/uniprot/E5RGR5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8N0T1", "url": "https://www.uniprot.org/uniprot/Q8N0T1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8N0T1-1", "url": "https://www.uniprot.org/uniprot/Q8N0T1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8N0T1-2", "url": "https://www.uniprot.org/uniprot/Q8N0T1-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKINIMNEEKVNRVNKAFVNVQKELAHFAKSISLEPLQKELIPQQRHESKPVNVDEATRLMALL", "length": 100, "header": "sp|Q8N0T1-1|RBIS_HUMAN Isoform 1 of Ribosomal biogenesis factor OS=Homo sapiens OX=9606 GN=RBIS PE=1 SV=4 CANONICAL=Q8N0T1-1" }, "isoforms": [ { "isoform_ac": "A0A087WWE7-1", "url": "", "sequence": { "sequence": "MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKIPQQRHESKPVNVDEATRLMALL", "length": 61, "header": "tr|A0A087WWE7-1|RBIS_HUMAN Computationally mapped isoform of Ribosomal biogenesis factor OS=Homo sapiens OX=9606 GN=RBIS PE=1 SV=1 CANONICAL=Q8N0T1-1" }, "locus": { "chromosome": "8", "start_pos": 85217499, "end_pos": 85214563, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000545322.5", "url": "https://www.ensembl.org/id/ENST00000545322.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000444092.2", "url": "https://www.ensembl.org/id/ENSP00000444092.2" } ] } }, { "isoform_ac": "E5RGR5-1", "url": "", "sequence": { "sequence": "MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKINIMNEE", "length": 45, "header": "tr|E5RGR5-1|RBIS_HUMAN Computationally mapped isoform of Ribosomal biogenesis factor OS=Homo sapiens OX=9606 GN=RBIS PE=1 SV=1 CANONICAL=Q8N0T1-1" }, "locus": { "chromosome": "8", "start_pos": 85217499, "end_pos": 85215017, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000523281.5", "url": "https://www.ensembl.org/id/ENST00000523281.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000428722.1", "url": "https://www.ensembl.org/id/ENSP00000428722.1" } ] } }, { "isoform_ac": "Q8N0T1-1", "url": "", "sequence": { "sequence": "MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKINIMNEEKVNRVNKAFVNVQKELAHFAKSISLEPLQKELIPQQRHESKPVNVDEATRLMALL", "length": 100, "header": "sp|Q8N0T1-1|RBIS_HUMAN Isoform 1 of Ribosomal biogenesis factor OS=Homo sapiens OX=9606 GN=RBIS PE=1 SV=4 CANONICAL=Q8N0T1-1" }, "locus": { "chromosome": "8", "start_pos": 85217499, "end_pos": 85214563, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000611854.4", "url": "https://www.ensembl.org/id/ENST00000611854.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000484811.1", "url": "https://www.ensembl.org/id/ENSP00000484811.1" } ] } }, { "isoform_ac": "Q8N0T1-2", "url": "", "sequence": { "sequence": "MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKVLHFS", "length": 43, "header": "sp|Q8N0T1-2|RBIS_HUMAN Isoform 2 of Ribosomal biogenesis factor OS=Homo sapiens OX=9606 GN=RBIS PE=1 SV=4 CANONICAL=Q8N0T1-1" }, "locus": { "chromosome": "8", "start_pos": 85217499, "end_pos": 85217278, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000321777.5", "url": "https://www.ensembl.org/id/ENST00000321777.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000319020.5", "url": "https://www.ensembl.org/id/ENSP00000319020.5" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q8N0T1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8N0T1" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" } ] } ], "phosphorylation": [ { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q8N0T1", "url": "https://www.uniprot.org/uniprot/Q8N0T1" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q8N0T1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8N0T1" } ], "site_lbl": "Ser19" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q8N0T1", "url": "https://www.uniprot.org/uniprot/Q8N0T1" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q8N0T1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8N0T1" } ], "site_lbl": "Ser69" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "E5RGR5", "url": "https://www.uniprot.org/uniprot/E5RGR5" }, { "database": "UniProtKB", "id": "A0A087WWE7", "url": "https://www.uniprot.org/uniprot/A0A087WWE7" }, { "database": "UniProtKB", "id": "Q8N0T1", "url": "https://www.uniprot.org/uniprot/Q8N0T1" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "Q8N0T1", "url": "https://www.uniprot.org/uniprot/Q8N0T1" }, { "database": "iPTMnet", "id": "Q8N0T1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8N0T1" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Genome-wide RNAi Screening Identifies Protein Modules Required for 40S Subunit Synthesis in Human Cells.", "journal": "Cell Rep.", "date": "2015", "authors": "Badertscher L, Wild T, Montellese C, Alexander LT, Bammert L, Sarazova M, Stebler M, Csucs G, Mayer TU, Zamboni N, Zemp I, Horvath P, Kutay U", "evidence": [ { "database": "UniProtKB", "id": "Q8N0T1", "url": "https://www.uniprot.org/uniprot/Q8N0T1" } ], "reference": [ { "type": "PubMed", "id": "26711351", "url": "https://glygen.org/publication/PubMed/26711351" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q8N0T1", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8N0T1" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] } ], "pathway": [ { "id": "hsa:401466", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:401466", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q0VG62-2", "protein_name": "Ribosomal biogenesis factor", "gene_name": "Rbis", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAKNKLKGQKSRNVFHIASHKTFKAKNKAKPVTTNLKKINIMNHEKVNRMNRAFVNIQKELANFSKSLSLKSVQKELKHHENEPANVDEATRLMAQL", "length": 97 }, "evidence": [ { "id": "45239600", "url": "http://www.informatics.jax.org/homology/45239600", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q8N0T1", "url": "https://www.uniprot.org/uniprot/Q8N0T1" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "Q8N0T1", "url": "https://www.uniprot.org/uniprot/Q8N0T1" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q8N0T1", "url": "https://www.uniprot.org/uniprot/Q8N0T1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "ribosome biogenesis", "id": "GO:0042254", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042254", "evidence": [ { "database": "UniProtKB", "id": "Q8N0T1", "url": "https://www.uniprot.org/uniprot/Q8N0T1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }