{ "uniprot_canonical_ac": "Q8K4P2-1", "uniprot_ac": "Q8K4P2", "uniprot_id": "NPB_RAT", "mass": { "chemical_mass": 13019.0, "monoisotopic_mass": 13019.0 }, "refseq": { "ac": "NP_695205", "name": "neuropeptide B precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_695205" }, "gene_names": [ { "name": "Anapc11", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8K4P2", "id": "Q8K4P2" }, { "name": "Npb", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8K4P2", "id": "Q8K4P2" }, { "name": "Npb", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_695205", "id": "NP_695205" } ], "protein_names": [ { "name": "Neuropeptide B", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8K4P2" }, { "name": "L7C", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8K4P2" }, { "name": "Preproprotein L7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8K4P2" }, { "name": "anaphase-promoting complex subunit 11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001119554", "id": "NP_001119554" }, { "name": "neuropeptide B precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_695205", "id": "NP_695205" }, { "name": "rPPL7; preproprotein L7; preproneuropeptide B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_695205", "id": "NP_695205" }, { "name": "rPPL7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8K4P2" } ], "function": [ { "annotation": "Demonstrates the expression patterns of GPR7, NPB, and NPW precursor messenger ribonucleic acid (mRNA) in the rat brain by using in situ hybridization and in situ binding experiments", "evidence": [ { "database": "RefSeq", "id": "NP_695205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_695205" }, { "database": "PubMed", "id": "16736466", "url": "https://glygen.org/publication/PubMed/16736466" } ] }, { "annotation": "Identification of NPB, NPW and Their Receptor in the Rat Heart. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_695205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_695205" }, { "database": "PubMed", "id": "33105700", "url": "https://glygen.org/publication/PubMed/33105700" } ] }, { "annotation": "May be involved in the regulation of feeding, neuroendocrine system, memory and learning. May be involved in the afferent pain pathway (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2#function" } ] }, { "annotation": "NPB-immunoreactivity was enriched in many regions within the hypothalamus which also contained high levels of GPR7 mRNA.", "evidence": [ { "database": "RefSeq", "id": "NP_695205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_695205" }, { "database": "PubMed", "id": "17067739", "url": "https://glygen.org/publication/PubMed/17067739" } ] }, { "annotation": "Neuropeptide B, a neuropeptide modified with bromine is an endogenous ligand for GPR7.", "evidence": [ { "database": "RefSeq", "id": "NP_695205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_695205" }, { "database": "PubMed", "id": "12118011", "url": "https://glygen.org/publication/PubMed/12118011" } ] }, { "annotation": "RT-PCR technique revealed the presence of NPB mRNA, NPW mRNA, and NPBWR1 mRNA, but not similar to NPBWR2 mRNA in ROB cells.", "evidence": [ { "database": "RefSeq", "id": "NP_695205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_695205" }, { "database": "PubMed", "id": "19885618", "url": "https://glygen.org/publication/PubMed/19885618" } ] }, { "annotation": "The Neuropeptide B can affect glucose and lipid homeostasis, and food intake in rats.", "evidence": [ { "database": "RefSeq", "id": "NP_695205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_695205" }, { "database": "PubMed", "id": "22484289", "url": "https://glygen.org/publication/PubMed/22484289" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" } ], "common_name": "Rat" } ], "gene": [ { "name": "Npb", "url": "https://www.uniprot.org/uniprot/Q8K4P2", "locus": { "chromosome": "10", "start_pos": 105887254, "end_pos": 105874708, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000036686", "url": "https://www.ensembl.org/id/ENSRNOG00000036686" } ] } } ], "crossref": [ { "id": "ENSRNOG00000036685", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000036685", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "ENSRNOG00000036686", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000036686", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd16456", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16456", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "259222", "url": "https://www.ncbi.nlm.nih.gov/gene/259222", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "498030", "url": "https://www.ncbi.nlm.nih.gov/gene/498030", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001841", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001841", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013297", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013297", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013298", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013298", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024991", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024991", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:259222", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:259222", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "rno:498030", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:498030", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "VQCAMER", "url": "https://omabrowser.org/oma/group/VQCAMER/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3546417at2759", "url": "http://www.orthodb.org/?query=3546417at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "4636690at2759", "url": "http://www.orthodb.org/?query=4636690at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11210", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11210", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11210:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11210:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28553", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28553", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28553:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28553:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF12861", "url": "http://pfam.xfam.org/family/PF12861", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF15180", "url": "http://pfam.xfam.org/family/PF15180", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_D3ZXH8", "url": "http://purl.obolibrary.org/obo/PR_D3ZXH8", "database": "PRO", "categories": [ "Protein" ] }, { "id": "PR_Q8K4P2", "url": "http://purl.obolibrary.org/obo/PR_Q8K4P2", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-141430", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-141430", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-174048", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174048", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-174084", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174084", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-174154", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174154", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174178", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-174184", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174184", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-176407", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-176407", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-176408", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-176408", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-176412", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-176412", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-179409", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-179409", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2467813", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2559582", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-375276", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-418594", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-68867", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-69017", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-69017", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983168", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_695205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_695205", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1561880", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1561880", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "708513", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=708513", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "D3ZXH8", "url": "https://www.uniprot.org/uniprot/D3ZXH8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZXH8-1", "url": "https://www.uniprot.org/uniprot/D3ZXH8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8K4P2-1", "url": "https://www.uniprot.org/uniprot/Q8K4P2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVRCRTLVAAALALLLTPALAWYKPAAGSHHYSVGRAAGLLSSFHRFPSTRRSESPALRVGTVPLRNLEMRPSVRSLALCVKDVTPNLQSCQRQLNSRGTFQCKADVFLSLHKAECQSA", "length": 119, "header": "sp|Q8K4P2-1|NPB_RAT Isoform 1 of Neuropeptide B OS=Rattus norvegicus OX=10116 GN=Npb PE=2 SV=1 CANONICAL=Q8K4P2-1" }, "isoforms": [ { "isoform_ac": "D3ZXH8-1", "url": "", "sequence": { "sequence": "MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLNAQQVQQHCPMCRQEWKFKE", "length": 84, "header": "tr|D3ZXH8-1|D3ZXH8_RAT Computationally mapped isoform of Anaphase-promoting complex subunit 11 OS=Rattus norvegicus OX=10116 GN=Anapc11 PE=3 SV=1 CANONICAL=Q8K4P2-1" }, "locus": { "chromosome": "10", "start_pos": 105887083, "end_pos": 105886652, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000054954", "url": "https://www.ensembl.org/id/ENSRNOT00000054954" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000051837", "url": "https://www.ensembl.org/id/ENSRNOP00000051837" } ] } }, { "isoform_ac": "Q8K4P2-1", "url": "", "sequence": { "sequence": "MVRCRTLVAAALALLLTPALAWYKPAAGSHHYSVGRAAGLLSSFHRFPSTRRSESPALRVGTVPLRNLEMRPSVRSLALCVKDVTPNLQSCQRQLNSRGTFQCKADVFLSLHKAECQSA", "length": 119, "header": "sp|Q8K4P2-1|NPB_RAT Isoform 1 of Neuropeptide B OS=Rattus norvegicus OX=10116 GN=Npb PE=2 SV=1 CANONICAL=Q8K4P2-1" }, "locus": { "chromosome": "10", "start_pos": 105887083, "end_pos": 105886652, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000054954", "url": "https://www.ensembl.org/id/ENSRNOT00000054954" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000051837", "url": "https://www.ensembl.org/id/ENSRNOP00000051837" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Identification of a neuropeptide modified with bromine as an endogenous ligand for GPR7.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Fujii R, Yoshida H, Fukusumi S, Habata Y, Hosoya M, Kawamata Y, Yano T, Hinuma S, Kitada C, Asami T, Mori M, Fujisawa Y, Fujino M", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" }, { "database": "RefSeq", "id": "NP_695205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_695205" } ], "reference": [ { "type": "PubMed", "id": "12118011", "url": "https://glygen.org/publication/PubMed/12118011" } ] }, { "title": "A study of the rat neuropeptide B/neuropeptide W system using in situ techniques.", "journal": "The Journal of comparative neurology", "date": "2006", "authors": "Jackson VR, Lin SH, Wang Z, Nothacker HP, Civelli O", "evidence": [ { "database": "RefSeq", "id": "NP_695205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_695205" } ], "reference": [ { "type": "PubMed", "id": "16736466", "url": "https://glygen.org/publication/PubMed/16736466" } ] }, { "title": "Immunofluorescent identification of neuropeptide B-containing nerve fibers and terminals in the rat hypothalamus.", "journal": "Neuroscience letters", "date": "2007", "authors": "Schulz S, Stumm R, Hollt V", "evidence": [ { "database": "RefSeq", "id": "NP_695205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_695205" } ], "reference": [ { "type": "PubMed", "id": "17067739", "url": "https://glygen.org/publication/PubMed/17067739" } ] }, { "title": "Neuropeptide B (NPB) and neuropeptide W (NPW) system in cultured rat calvarial osteoblast-like (ROB) cells: NPW and NPB inhibit proliferative activity of ROB cells.", "journal": "International journal of molecular medicine", "date": "2009", "authors": "Ziolkowska A, Rucinski M, Tyczewska M, Malendowicz LK", "evidence": [ { "database": "RefSeq", "id": "NP_695205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_695205" } ], "reference": [ { "type": "PubMed", "id": "19885618", "url": "https://glygen.org/publication/PubMed/19885618" } ] }, { "title": "Neuropeptide B and W regulate leptin and resistin secretion, and stimulate lipolysis in isolated rat adipocytes.", "journal": "Regulatory peptides", "date": "2012", "authors": "Skrzypski M, Pruszynska-Oszmalek E, Rucinski M, Szczepankiewicz D, Sassek M, Wojciechowicz T, Kaczmarek P, Kolodziejski PA, Strowski MZ, Malendowicz LK, Nowak KW", "evidence": [ { "database": "RefSeq", "id": "NP_695205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_695205" } ], "reference": [ { "type": "PubMed", "id": "22484289", "url": "https://glygen.org/publication/PubMed/22484289" } ] }, { "title": "Identification of NPB, NPW and Their Receptor in the Rat Heart.", "journal": "International journal of molecular sciences", "date": "2020", "authors": "Pandey S, Tuma Z, Peroni E, Monasson O, Papini AM, Chottova Dvorakova M", "evidence": [ { "database": "RefSeq", "id": "NP_695205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_695205" } ], "reference": [ { "type": "PubMed", "id": "33105700", "url": "https://glygen.org/publication/PubMed/33105700" } ] } ], "pathway": [ { "id": "rno:259222", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:259222", "resource": "KEGG Pathway" }, { "id": "rno:498030", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:498030", "resource": "KEGG Pathway" }, { "id": "R-RNO-141430", "name": "Inactivation of APC/C via direct inhibition of the APC/C complex", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-141430", "resource": "Reactome", "description": "Inactivation of APC/C via direct inhibition of the APC/C complex" }, { "id": "R-RNO-174048", "name": "APC/C:Cdc20 mediated degradation of Cyclin B", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174048", "resource": "Reactome", "description": "APC/C:Cdc20 mediated degradation of Cyclin B" }, { "id": "R-RNO-174084", "name": "Autodegradation of Cdh1 by Cdh1:APC/C", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174084", "resource": "Reactome", "description": "Autodegradation of Cdh1 by Cdh1:APC/C" }, { "id": "R-RNO-174154", "name": "APC/C:Cdc20 mediated degradation of Securin", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174154", "resource": "Reactome", "description": "APC/C:Cdc20 mediated degradation of Securin" }, { "id": "R-RNO-174178", "name": "APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174178", "resource": "Reactome", "description": "APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1" }, { "id": "R-RNO-174184", "name": "Cdc20:Phospho-APC/C mediated degradation of Cyclin A", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174184", "resource": "Reactome", "description": "Cdc20:Phospho-APC/C mediated degradation of Cyclin A" }, { "id": "R-RNO-176407", "name": "Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-176407", "resource": "Reactome", "description": "Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase" }, { "id": "R-RNO-176408", "name": "Regulation of APC/C activators between G1/S and early anaphase", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-176408", "resource": "Reactome", "description": "Regulation of APC/C activators between G1/S and early anaphase" }, { "id": "R-RNO-176412", "name": "Phosphorylation of the APC/C", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-176412", "resource": "Reactome", "description": "Phosphorylation of the APC/C" }, { "id": "R-RNO-179409", "name": "APC-Cdc20 mediated degradation of Nek2A", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-179409", "resource": "Reactome", "description": "APC-Cdc20 mediated degradation of Nek2A" }, { "id": "R-RNO-2467813", "name": "Separation of Sister Chromatids", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2467813", "resource": "Reactome", "description": "Separation of Sister Chromatids" }, { "id": "R-RNO-2559582", "name": "Senescence-Associated Secretory Phenotype (SASP)", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2559582", "resource": "Reactome", "description": "Senescence-Associated Secretory Phenotype (SASP)" }, { "id": "R-RNO-375276", "name": "Peptide ligand-binding receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-375276", "resource": "Reactome", "description": "Peptide ligand-binding receptors" }, { "id": "R-RNO-418594", "name": "G alpha (i) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-418594", "resource": "Reactome", "description": "G alpha (i) signalling events" }, { "id": "R-RNO-68867", "name": "Assembly of the pre-replicative complex", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-68867", "resource": "Reactome", "description": "Assembly of the pre-replicative complex" }, { "id": "R-RNO-69017", "name": "CDK-mediated phosphorylation and removal of Cdc6", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-69017", "resource": "Reactome", "description": "CDK-mediated phosphorylation and removal of Cdc6" }, { "id": "R-RNO-983168", "name": "Antigen processing: Ubiquitination & Proteasome degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983168", "resource": "Reactome", "description": "Antigen processing: Ubiquitination & Proteasome degradation" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8K4P1-1", "protein_name": "Neuropeptide B", "gene_name": "Npb", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARCRTLVAAALALLLPPALAWYKPAAGPHHYSVGRASGLLSSFHRFPSTRRSESPALRVGTGPLRNLEMRPSVRSLALCVKDVTPNLQSCQRQLNSRGTFQCKADVFLSLHETDCQST", "length": 119 }, "evidence": [ { "id": "45226490", "url": "http://www.informatics.jax.org/homology/45226490", "database": "MGI" }, { "id": "Q8K4P2", "url": "https://omabrowser.org/oma/group/Q8K4P2/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8NG41-1", "protein_name": "Neuropeptide B", "gene_name": "NPB", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARSATLAAAALALCLLLAPPGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPYARRSQPYRGAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAADCLAA", "length": 125 }, "evidence": [ { "id": "45226490", "url": "http://www.informatics.jax.org/homology/45226490", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9CPX9-1", "protein_name": "Anaphase-promoting complex subunit 11", "gene_name": "Anapc11", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLNAQQVQQHCPMCRQEWKFKE", "length": 84 }, "evidence": [ { "id": "45237042", "url": "http://www.informatics.jax.org/homology/45237042", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9NYG5-1", "protein_name": "Anaphase-promoting complex subunit 11", "gene_name": "ANAPC11", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE", "length": 84 }, "evidence": [ { "id": "45237042", "url": "http://www.informatics.jax.org/homology/45237042", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" } ], "pmid": "" }, { "name": "anaphase-promoting complex", "id": "GO:0005680", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005680", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 9, "go_terms": [ { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" } ], "pmid": "" }, { "name": "neuropeptide signaling pathway", "id": "GO:0007218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007218", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" } ], "pmid": "" }, { "name": "feeding behavior", "id": "GO:0007631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007631", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" } ], "pmid": "" }, { "name": "cell division", "id": "GO:0051301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" } ], "pmid": "" }, { "name": "protein ubiquitination", "id": "GO:0016567", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" } ], "pmid": "" }, { "name": "anaphase-promoting complex-dependent catabolic process", "id": "GO:0031145", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031145", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" } ], "pmid": "" }, { "name": "protein K11-linked ubiquitination", "id": "GO:0070979", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070979", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" } ], "pmid": "" }, { "name": "positive regulation of mitotic metaphase/anaphase transition", "id": "GO:0045842", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045842", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" } ], "pmid": "" }, { "name": "ubiquitin-dependent protein catabolic process", "id": "GO:0006511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006511", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "G protein-coupled receptor binding", "id": "GO:0001664", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001664", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" } ], "pmid": "" }, { "name": "ubiquitin protein ligase activity", "id": "GO:0061630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061630", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" } ], "pmid": "" }, { "name": "ubiquitin-ubiquitin ligase activity", "id": "GO:0034450", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034450", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" } ], "pmid": "" }, { "name": "cullin family protein binding", "id": "GO:0097602", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097602", "evidence": [ { "database": "UniProtKB", "id": "Q8K4P2", "url": "https://www.uniprot.org/uniprot/Q8K4P2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }