{ "uniprot_canonical_ac": "Q8K480-1", "uniprot_ac": "Q8K480", "uniprot_id": "MFRP_MOUSE", "mass": { "chemical_mass": 63669.0, "monoisotopic_mass": 63669.0 }, "refseq": { "ac": "NP_001177242", "name": "complement C1q tumor necrosis factor-related protein 5 precursor", "summary": "The protein encoded by this gene is a member of the C1q/tumor necrosis factor superfamily. This family member is a secretory protein that functions in eye development. Mutations in this gene are thought to underlie the pathophysiology of late-onset retinal degeneration (L-ORD) and early-onset long anterior zonules (LAZ). Bicistronic transcripts composed of the coding sequences for this gene (C1qtnf5) and the membrane-type frizzled-related protein gene (Mfrp) have been identified, and the resulting products can interact with each other. Co-transcription of C1qtnf5 and Mfrp has been observed in both human and mouse. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2010].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177242" }, "gene_names": [ { "name": "Mfrp", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8K480", "id": "Q8K480" }, { "name": "Adie; Ctrp5; Mfrp", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177242", "id": "NP_001177242" }, { "name": "C1qtnf5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177242", "id": "NP_001177242" } ], "protein_names": [ { "name": "Membrane frizzled-related protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8K480" }, { "name": "Membrane-type frizzled-related protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8K480" }, { "name": "complement C1q tumor necrosis factor-related protein 5 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177242", "id": "NP_001177242" }, { "name": "complement C1q tumor necrosis factor-related protein 5; Membrane frizzled-related protein; adiponectin e", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177242", "id": "NP_001177242" } ], "function": [ { "annotation": "A Novel Mouse Model for Late-Onset Retinal Degeneration (L-ORD) Develops RPE Abnormalities Due to the Loss of C1qtnf5/Ctrp5.", "evidence": [ { "database": "RefSeq", "id": "NP_001177242", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177242" }, { "database": "PubMed", "id": "37440053", "url": "https://glygen.org/publication/PubMed/37440053" } ] }, { "annotation": "C1q/TNF-related protein 5 contributes to diabetic vascular endothelium dysfunction through promoting Nox-1 signaling.", "evidence": [ { "database": "RefSeq", "id": "NP_001177242", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177242" }, { "database": "PubMed", "id": "32122792", "url": "https://glygen.org/publication/PubMed/32122792" } ] }, { "annotation": "CTRP5, a secretory and membrane-associated protein, is localized to the lateral and apical membranes of the RPE and CB. Impaired secretion of the mutant protein may underlie the pathophysiology of long anterior zonules and late-onset retinal degeneration.", "evidence": [ { "database": "RefSeq", "id": "NP_001177242", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177242" }, { "database": "PubMed", "id": "17122142", "url": "https://glygen.org/publication/PubMed/17122142" } ] }, { "annotation": "L-ORMD is due to insufficient levels of secreted C1QTNF5, compromised RPE cell function resulting from ER retention of the mutant protein or both mechanisms.", "evidence": [ { "database": "RefSeq", "id": "NP_001177242", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177242" }, { "database": "PubMed", "id": "16600989", "url": "https://glygen.org/publication/PubMed/16600989" } ] }, { "annotation": "May play a role in eye development.", "evidence": [ { "database": "UniProtKB", "id": "Q8K480", "url": "https://www.uniprot.org/uniprot/Q8K480#function" } ] }, { "annotation": "The protein encoded by this gene is a member of the C1q/tumor necrosis factor superfamily. This family member is a secretory protein that functions in eye development. Mutations in this gene are thought to underlie the pathophysiology of late-onset retinal degeneration (L-ORD) and early-onset long anterior zonules (LAZ). Bicistronic transcripts composed of the coding sequences for this gene (C1qtnf5) and the membrane-type frizzled-related protein gene (Mfrp) have been identified, and the resulting products can interact with each other. Co-transcription of C1qtnf5 and Mfrp has been observed in both human and mouse. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2010].", "evidence": [ { "database": "RefSeq", "id": "NP_001177242", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177242" } ] } ], "disease": [ { "disease_id": "DOID:0060837", "recommended_name": { "id": "DOID:0060837", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060837", "name": "isolated microphthalmia 5", "description": "An isolated microphthalmia characterized by autosomal recessive inheritance of posterior microphthalmia, hypermetropia, night blindness, decreased visual acuity, reduced macular reflex, scleral thickening, impared rod and cone responses on ERG, foveoschisis and in some patients retinal pigment epithelium atrophy, arteriolar attenuation, angle-closure glaucoma and optic disc drusen that has_material_basis_in homozygous or compound heterozygous mutation in the MFRP gene on chromosome 11q23." }, "synonyms": [ { "id": "DOID:0060837", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060837", "name": "MCOP5", "description": "" }, { "id": "DOID:0060837", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060837", "name": "microphthalmia-retinitis pigmentosa-foveoschisis-optic disc drusen syndrome", "description": "" }, { "id": "DOID:0060837", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060837", "name": "posterior microphthalmia with retinitis pigmentosa, foveoschisis and optic disc drusen", "description": "" }, { "id": "MONDO:0012605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012605", "name": "isolated microphthalmia 5", "description": "Any isolated microphthalmia in which the cause of the disease is a mutation in the MFRP gene." }, { "id": "MONDO:0012605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012605", "name": "MCOP5", "description": "" }, { "id": "MONDO:0012605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012605", "name": "MFRP isolated microphthalmia", "description": "" }, { "id": "MONDO:0012605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012605", "name": "Nanophtalmos-retinitis pigmentosa-foveoschisis-optic disc drusen syndrome", "description": "" }, { "id": "MONDO:0012605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012605", "name": "Nanophtalmos-retinitis pigmentosa-foveoschisis-optic disk drusen syndrome", "description": "" }, { "id": "MONDO:0012605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012605", "name": "isolated microphthalmia 5", "description": "" }, { "id": "MONDO:0012605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012605", "name": "isolated microphthalmia caused by mutation in MFRP", "description": "" }, { "id": "MONDO:0012605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012605", "name": "isolated microphthalmia type 5", "description": "" }, { "id": "MONDO:0012605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012605", "name": "microphthalmia, isolated type 5", "description": "" }, { "id": "MONDO:0012605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012605", "name": "microphthalmia-retinitis pigmentosa-foveoschisis-optic disc drusen syndrome", "description": "" }, { "id": "MONDO:0012605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012605", "name": "microphthalmia-retinitis pigmentosa-foveoschisis-optic disk drusen syndrome", "description": "" }, { "id": "MONDO:0012605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012605", "name": "posterior microphthalmia with retinitis pigmentosa, foveoschisis and optic disc drusen", "description": "" }, { "id": "MONDO:0012605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012605", "name": "posterior microphthalmia with retinitis pigmentosa, foveoschisis and optic disk drusen", "description": "" }, { "id": "MONDO:0012605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012605", "name": "microphthalmia, isolated 5", "description": "" }, { "id": "MONDO:0012605", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012605", "name": "microphthalmia, posterior, with retinitis pigmentosa, foveoschisis, and optic Disc drusen", "description": "" }, { "id": "MIM:611040", "resource": "MIM", "url": "https://www.omim.org/entry/611040", "name": "Microphthalmia, isolated, 5", "description": "Microphthalmia, isolated, 5" } ], "evidence": [ { "id": "0060837", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060837" } ] }, { "disease_id": "DOID:0080634", "recommended_name": { "id": "DOID:0080634", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080634", "name": "nanophthalmos", "description": "A microphthalmia that is characterized by a small eye with a short axial length, severe hyperopia, an elevated lens/eye ratio, and a high incidence of angle-closure glaucoma." }, "synonyms": [ { "id": "MONDO:0010836", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010836", "name": "nanophthalmos 1", "description": "" }, { "id": "MONDO:0010836", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010836", "name": "NNO1", "description": "" }, { "id": "MONDO:0010836", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010836", "name": "nanophthalmos 1", "description": "" }, { "id": "MONDO:0010836", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010836", "name": "nanophthalmos-1", "description": "" }, { "id": "MONDO:0010836", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010836", "name": "Nanophthalmia 1", "description": "" }, { "id": "MONDO:0010836", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010836", "name": "microphthalmos, simple, autosomal dominant", "description": "" }, { "id": "MONDO:0010836", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010836", "name": "nanophthalmos with high hyperopia and angle-closure glaucoma", "description": "" }, { "id": "MONDO:0010836", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010836", "name": "nanophthalmos, autosomal dominant", "description": "" }, { "id": "MONDO:0012754", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012754", "name": "nanophthalmos 3", "description": "" }, { "id": "MONDO:0012754", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012754", "name": "NNO3", "description": "" }, { "id": "MONDO:0012754", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012754", "name": "nanophthalmos 3", "description": "" }, { "id": "MONDO:0012754", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012754", "name": "Nanophthalmia 3", "description": "" }, { "id": "MONDO:0012299", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012299", "name": "nanophthalmos 2", "description": "Any nanophthalmia in which the cause of the disease is a mutation in the MFRP gene." }, { "id": "MONDO:0012299", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012299", "name": "MFRP nanophthalmia", "description": "" }, { "id": "MONDO:0012299", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012299", "name": "nanophthalmia caused by mutation in MFRP", "description": "" }, { "id": "MONDO:0012299", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012299", "name": "nanophthalmos 2", "description": "" }, { "id": "MONDO:0012299", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012299", "name": "nanophthalmos type 2", "description": "" }, { "id": "MONDO:0012299", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012299", "name": "NNO2", "description": "" }, { "id": "MONDO:0012299", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012299", "name": "Nanophthalmia 2", "description": "" }, { "id": "MONDO:0012299", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012299", "name": "nanophthalmos, autosomal recessive", "description": "" }, { "id": "MONDO:0014426", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014426", "name": "nanophthalmos 4", "description": "Any nanophthalmia in which the cause of the disease is a mutation in the TMEM98 gene." }, { "id": "MONDO:0014426", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014426", "name": "TMEM98 nanophthalmia", "description": "" }, { "id": "MONDO:0014426", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014426", "name": "nanophthalmia caused by mutation in TMEM98", "description": "" }, { "id": "MONDO:0014426", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014426", "name": "nanophthalmos 4", "description": "" }, { "id": "MONDO:0014426", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014426", "name": "nanophthalmos type 4", "description": "" }, { "id": "MONDO:0014426", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014426", "name": "NNO4", "description": "" }, { "id": "MONDO:0014426", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014426", "name": "Nanophthalmia 4", "description": "" }, { "id": "MIM:609549", "resource": "MIM", "url": "https://www.omim.org/entry/609549", "name": "Nanophthalmos 2", "description": "Nanophthalmos 2" }, { "id": "MIM:615972", "resource": "MIM", "url": "https://www.omim.org/entry/615972", "name": "Nanophthalmos 4", "description": "Nanophthalmos 4" } ], "evidence": [ { "id": "0080634", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080634" } ] }, { "disease_id": "DOID:10584", "recommended_name": { "id": "DOID:10584", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10584", "name": "retinitis pigmentosa", "description": "A retinal degeneration characterized by the gradual deterioration of the photoreceptors or the retinal pigment epithelium of the retina leading to progressive sight loss." }, "synonyms": [ { "id": "DOID:10584", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10584", "name": "pericentral pigmentary retinopathy", "description": "" }, { "id": "MONDO:0019200", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019200", "name": "retinitis pigmentosa", "description": "Retinitis pigmentosa (RP) is an inherited retinal dystrophy leading to progressive loss of the photoreceptors and retinal pigment epithelium and resulting in blindness usually after several decades." }, { "id": "MONDO:0019200", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019200", "name": "retinitis pigmentosa", "description": "" }, { "id": "MONDO:0019200", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019200", "name": "pericentral pigmentary retinopathy", "description": "" }, { "id": "MONDO:0019200", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019200", "name": "Rod-cone dystrophy", "description": "" }, { "id": "MIM:268000", "resource": "MIM", "url": "https://www.omim.org/entry/268000", "name": "Retinitis pigmentosa", "description": "Retinitis pigmentosa" } ], "evidence": [ { "id": "10584", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10584" } ] }, { "disease_id": "DOID:10629", "recommended_name": { "id": "DOID:10629", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10629", "name": "microphthalmia", "description": "An eye disease where one or both eyeballs are abnormally small." }, "synonyms": [ { "id": "DOID:10629", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10629", "name": "microphthalmos", "description": "" }, { "id": "DOID:10629", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10629", "name": "simple microphthalmos", "description": "" } ], "evidence": [ { "id": "10629", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10629" } ] }, { "disease_id": "DOID:11105", "recommended_name": { "id": "DOID:11105", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11105", "name": "fundus albipunctatus", "description": "A fundus dystrophy that is characterized by discrete uniform white dots over the entire fundus with greatest density in the midperiphery and no macular involvement." }, "synonyms": [ { "id": "DOID:11105", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11105", "name": "Pigmentary retinal dystrophy", "description": "" }, { "id": "DOID:11105", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11105", "name": "retinitis punctata albescens", "description": "" }, { "id": "MONDO:0007639", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007639", "name": "fundus albipunctatus", "description": "Fundus albipunctatus is a rare, genetic retinal dystrophy characterized by the presence of numerous small, round, yellowish-white retinal lesions that are distributed throughout the retina but spare the fovea. Patients present in childhood with non-progressive night blindness with prolonged cone and rod adaptation times. The macula may or may not be involved, which may result in a decrease of central visual acuity with age." }, { "id": "MONDO:0007639", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007639", "name": "retinitis punctata albescens", "description": "" }, { "id": "MONDO:0007639", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007639", "name": "fundus albipunctatus", "description": "" }, { "id": "MONDO:0007639", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007639", "name": "pigmentary retinal dystrophy", "description": "" }, { "id": "MIM:136880", "resource": "MIM", "url": "https://www.omim.org/entry/136880", "name": "Fundus albipunctatus", "description": "Fundus albipunctatus" } ], "evidence": [ { "id": "11105", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11105" } ] }, { "disease_id": "DOID:9834", "recommended_name": { "id": "DOID:9834", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9834", "name": "hyperopia", "description": "A refractive error that is characterized by rays of light entering the eye parallel to the optic axis are brought to a focus behind the retina, as a result of the eyeball being too short from front to back." }, "synonyms": [ { "id": "DOID:9834", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9834", "name": "Far-sightedness", "description": "" }, { "id": "DOID:9834", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9834", "name": "hypermetropia", "description": "" }, { "id": "DOID:9834", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9834", "name": "farsightedness", "description": "" } ], "evidence": [ { "id": "9834", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9834" } ] } ], "snv": [ { "evidence": [ { "id": "rs3389046214", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389046214" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 123, "end_pos": 123, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TTT->NTT).", "chr_id": "9", "chr_pos": "44013859", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T123", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8K480", "url": "https://www.uniprot.org/uniprot/Q8K480" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Mfrp", "url": "https://www.uniprot.org/uniprot/Q8K480", "locus": { "chromosome": "9", "start_pos": 44020484, "end_pos": 44013026, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000034739", "url": "https://www.ensembl.org/id/ENSMUSG00000034739" } ] } } ], "crossref": [ { "id": "ENSMUSG00000034739", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000034739", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00041", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00041", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00112", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00112", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd07066", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07066", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "235312", "url": "https://www.ncbi.nlm.nih.gov/gene/235312", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "259172", "url": "https://www.ncbi.nlm.nih.gov/gene/259172", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0001441", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0001441", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0002311", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0002311", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0006794", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0006794", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0006795", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0006795", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "Q8K480", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q8K480*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000859", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000859", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002172", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002172", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015526", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015526", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020067", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020067", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023415", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023415", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035914", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035914", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036055", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036055", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036790", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036790", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:259172", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:259172", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2385957", "url": "http://www.informatics.jax.org/marker/MGI:2385957", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "CKLDYVE", "url": "https://omabrowser.org/oma/group/CKLDYVE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5317198at2759", "url": "http://www.orthodb.org/?query=5317198at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11309", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11309", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24251", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24251", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24251:SF36", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24251:SF36", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00057", "url": "http://pfam.xfam.org/family/PF00057", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00431", "url": "http://pfam.xfam.org/family/PF00431", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01392", "url": "http://pfam.xfam.org/family/PF01392", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8K480", "url": "http://purl.obolibrary.org/obo/PR_Q8K480", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001177242", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177242", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0U1RNN1", "url": "https://www.uniprot.org/uniprot/A0A0U1RNN1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0U1RNN1-1", "url": "https://www.uniprot.org/uniprot/A0A0U1RNN1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0U1RNR7", "url": "https://www.uniprot.org/uniprot/A0A0U1RNR7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0U1RNR7-1", "url": "https://www.uniprot.org/uniprot/A0A0U1RNR7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0U1RPV4", "url": "https://www.uniprot.org/uniprot/A0A0U1RPV4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0U1RPV4-1", "url": "https://www.uniprot.org/uniprot/A0A0U1RPV4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E0CXS1", "url": "https://www.uniprot.org/uniprot/E0CXS1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E0CXS1-1", "url": "https://www.uniprot.org/uniprot/E0CXS1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8K480", "url": "https://www.uniprot.org/uniprot/Q8K480", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8K480-1", "url": "https://www.uniprot.org/uniprot/Q8K480-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8K480-2", "url": "https://www.uniprot.org/uniprot/Q8K480-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKDYDDVILRPEASELSKTEFCNPAFDPEAGPSCPPPALQRDVGSRLQAPWHAQRLRGLQPDCHFSWFCILLLSGLLLLLLGLLVAVILAQLQATSLPRTTKNPLLTRGLTPMGVIPSTTPNTTTTTTTTTPARTGQQEAAMSPTHQTTCGGLLPGPSGFFSSPNYPDLYPPLSHCVWHIQVAAGQTIQLKIQALSIESMLTCLFDRLEIISEPTGPLLRVCGKTPPATLNTNTSHLRVSFVSDNDVEGSGFQAWYQAVAPGHWSCAHNEFHCDLLLCLKRDSVCDGITECADGSDEANCSAKTLGCGGNLTGLYGVFSTPNYPQHYPHQQLCTWYIEVPVGYGIRLEFHNFSLEAQAECKFDYVEVYEASNLGTFSFLGRFCGAEPPLNVVSSMHQLAVIFKTDLGISSGGFLATYQAINTTESGCPWAEFCQSGGYRDLQWMCDLWKDCANDSNDNCSSHLSPQPDLTCEPVQVEMCLGLSYNTTAFPNIWVGLATQTEVTDILRGYKSLTSLPCYQTFQRFLCGLLVPRCTSLGTILPPCRSVCQAAEQQCQSSLALLGTPWPFNCNRLPVAASLEACSQP", "length": 584, "header": "sp|Q8K480-1|MFRP_MOUSE Isoform 1 of Membrane frizzled-related protein OS=Mus musculus OX=10090 GN=Mfrp PE=1 SV=1 CANONICAL=Q8K480-1" }, "isoforms": [ { "isoform_ac": "A0A0U1RNN1-1", "url": "", "sequence": { "sequence": "MKDYDDVILRPEASELSKPSVSGGYSPTATSPGSVFCFSVACCSCCWGYWWLSSWLSCRLHPSPGLPRTHCSPEASPPWVSFPAPPLTPPPPPPLPPQQGQGSRRQP", "length": 107, "header": "tr|A0A0U1RNN1-1|MFRP_MOUSE Computationally mapped isoform of Membrane frizzled-related protein OS=Mus musculus OX=10090 GN=Mfrp PE=1 SV=1 CANONICAL=Q8K480-1" }, "locus": { "chromosome": "9", "start_pos": 44013915, "end_pos": 44013190, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000205282.2", "url": "https://www.ensembl.org/id/ENSMUST00000205282.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000145633.2", "url": "https://www.ensembl.org/id/ENSMUSP00000145633.2" } ] } }, { "isoform_ac": "A0A0U1RNR7-1", "url": "", "sequence": { "sequence": "MKDYDDVILRPEASELSKTEFCNPAFDPEAGPSCPPPALQRDVGSRLQAPWHAQRLRGLQPDCHFSWFCILLLSGLLLLLLGLLVAVILAQLQATSLPRTTKNPLLTRGLTPMGVIPSTTPNTTTTTTTTTPARTGQQEAAMSPTHQTTCGGLLPGPSGFFSSPNYPDLYPPLSHCVWHIQVAAGQTIQLKIQALSIESMLTCLFDRLEIISEPTGPLLRVCGKTPPATLNTNTSHLRVSFVSDNDVEGSGFQAWYQAVAPGHWSCAHNEFHCDLLLCLKRDSVCDGITECADGSDEANCSAKTLGCGGNLTGLYGVFSTPNYPQHYPHQQLCTWYIEVPVGYGIRLEFHNFSLEAQAECKFDYVEVYEASNLGTFSFLGRFCGAEPPLNVVSSMHQLAVIFKTDLGISSGGFLATYQAINTTENLCGPTEFCQSGGYRDLQWMCDLWKDCANDSNDNCSSHLSPQPDLTCEPVQVEMCLGLSYNTTAFPNIWVGLATQTEVTDILRGYKSLTSLPCYQTFQRFLCGLLVPRCTSLGTILPPCRSVCQAAEQQCQSSLALLGTPWPFNCNRLPVAASLEACSQP", "length": 584, "header": "tr|A0A0U1RNR7-1|A0A0U1RNR7_MOUSE Computationally mapped isoform of Membrane frizzled-related protein OS=Mus musculus OX=10090 GN=Mfrp PE=1 SV=1 CANONICAL=Q8K480-1" }, "locus": { "chromosome": "9", "start_pos": 44017761, "end_pos": 44013190, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000206308.2", "url": "https://www.ensembl.org/id/ENSMUST00000206308.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000145676.2", "url": "https://www.ensembl.org/id/ENSMUSP00000145676.2" } ] } }, { "isoform_ac": "A0A0U1RPV4-1", "url": "", "sequence": { "sequence": "XNVVSSMHQLAVIFKTDLGISSGGFLATYQAINTTESGCPWADLCGPTEFCQSGGYRDLQWMCDLWKDCANDSNDNCSSHLSPQPDLTCEPVQVEMCLGLSYNTTAFPNIWVGLATQTEVTDILRGYKSLTSLPCYQTFQRFLCGLLVPRCTSLGTILPPCRSVCQAAEQQCQSSLALLGTPWPFNC", "length": 187, "header": "tr|A0A0U1RPV4-1|MFRP_MOUSE Computationally mapped isoform of Membrane frizzled-related protein OS=Mus musculus OX=10090 GN=Mfrp PE=1 SV=1 CANONICAL=Q8K480-1" }, "locus": { "chromosome": "9", "start_pos": 44017718, "end_pos": 44016473, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000206722.2", "url": "https://www.ensembl.org/id/ENSMUST00000206722.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000146138.2", "url": "https://www.ensembl.org/id/ENSMUSP00000146138.2" } ] } }, { "isoform_ac": "E0CXS1-1", "url": "", "sequence": { "sequence": "MKDYDDVILRPEASELSKTEFCNPAFDPEAGPSCPPPALQRDVGSRLQAPWHAQRLRGLQPDCHFSWFCILLLSGLLLLLLGLLVAVILAQLQATSLPRTTKNPLLTRGLTPMGVIPSTTPNTTTTTTTTTPARTGQQEAAMSPTHQTTCGGLLPGPSGFFSSPNYPDLYPPLSHCVWHIQVAAGQTIQLKIQALSIESMLTCLFDRLEIISEPTGPLLRVCGKTPPATLNTNTSHLRVSFVSDNDVEGSGFQAWYQAVAPGHWSCAHNEFHCDLLLCLKRDSVCDGITECADGSDEANCSAKTLGSVEQSHHSTLSPRCTSWL", "length": 324, "header": "tr|E0CXS1-1|MFRP_MOUSE Computationally mapped isoform of Membrane frizzled-related protein OS=Mus musculus OX=10090 GN=Mfrp PE=1 SV=2 CANONICAL=Q8K480-1" }, "locus": { "chromosome": "9", "start_pos": 44016504, "end_pos": 44013190, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000161703.8", "url": "https://www.ensembl.org/id/ENSMUST00000161703.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000125053.3", "url": "https://www.ensembl.org/id/ENSMUSP00000125053.3" } ] } }, { "isoform_ac": "Q8K480-1", "url": "", "sequence": { "sequence": "MKDYDDVILRPEASELSKTEFCNPAFDPEAGPSCPPPALQRDVGSRLQAPWHAQRLRGLQPDCHFSWFCILLLSGLLLLLLGLLVAVILAQLQATSLPRTTKNPLLTRGLTPMGVIPSTTPNTTTTTTTTTPARTGQQEAAMSPTHQTTCGGLLPGPSGFFSSPNYPDLYPPLSHCVWHIQVAAGQTIQLKIQALSIESMLTCLFDRLEIISEPTGPLLRVCGKTPPATLNTNTSHLRVSFVSDNDVEGSGFQAWYQAVAPGHWSCAHNEFHCDLLLCLKRDSVCDGITECADGSDEANCSAKTLGCGGNLTGLYGVFSTPNYPQHYPHQQLCTWYIEVPVGYGIRLEFHNFSLEAQAECKFDYVEVYEASNLGTFSFLGRFCGAEPPLNVVSSMHQLAVIFKTDLGISSGGFLATYQAINTTESGCPWAEFCQSGGYRDLQWMCDLWKDCANDSNDNCSSHLSPQPDLTCEPVQVEMCLGLSYNTTAFPNIWVGLATQTEVTDILRGYKSLTSLPCYQTFQRFLCGLLVPRCTSLGTILPPCRSVCQAAEQQCQSSLALLGTPWPFNCNRLPVAASLEACSQP", "length": 584, "header": "sp|Q8K480-1|MFRP_MOUSE Isoform 1 of Membrane frizzled-related protein OS=Mus musculus OX=10090 GN=Mfrp PE=1 SV=1 CANONICAL=Q8K480-1" }, "locus": { "chromosome": "9", "start_pos": 44017761, "end_pos": 44013190, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000034654", "url": "https://www.ensembl.org/id/ENSMUST00000034654" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000034654", "url": "https://www.ensembl.org/id/ENSMUSP00000034654" } ] } }, { "isoform_ac": "Q8K480-2", "url": "", "sequence": { "sequence": "MKDYDDVILRPEASELSKTEFCNPAFDPEAGPSCPPPALQRDVGSRLQAPWHAQRLRGLQPDCHFSWFCILLLSGLLLLLLGLLVAVILAQLQATSLPRTTKNPLLTRGLTPMGVIPSTTPNTTTTTTTTTPARTGQQEAAMSPTHQTTCGGLLPGPSGFFSSPNYPDLYPPLSHCVWHIQVAAGQTIQLKIQALSIESMLTCLFDRLEIISEPTGPLLRVCGKTPPATLNTNTSHLRVSFVSDNDVEGSGFQAWYQAVAPGHWSCAHNEFHCDLLLCLKRDSVCDGITECADGSDEANCSAKTLGCGGNLTGLYGVFSTPNYPQHYPHQQLCTWYIEVPVGYGIRLEFHNFSLEAQAECKFDYVEVYEASNLGTFSFLGRFCGAEPPLNVVSSMHQLAVIFKTDLGISSGGFLATYQAINTTEKFCQSGGYRDLQWMCDLWKDCANDSNDNCSSHLSPQPDLTCEPVQVEMCLGLSYNTTAFPNIWVGLATQTEVTDILRGYKSLTSLPCYQTFQRFLCGLLVPRCTSLGTILPPCRSVCQAAEQQCQSSLALLGTPWPFNCNRLPVAASLEACSQP", "length": 578, "header": "sp|Q8K480-2|MFRP_MOUSE Isoform 2 of Membrane frizzled-related protein OS=Mus musculus OX=10090 GN=Mfrp PE=1 SV=1 CANONICAL=Q8K480-1" }, "locus": { "chromosome": "9", "start_pos": 44017761, "end_pos": 44013190, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000161381", "url": "https://www.ensembl.org/id/ENSMUST00000161381" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000124456", "url": "https://www.ensembl.org/id/ENSMUSP00000124456" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 233, "start_aa": "Asn", "end_pos": 233, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn233", "evidence": [ { "id": "Q8K480", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K480#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 421, "start_aa": "Asn", "end_pos": 421, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn421", "evidence": [ { "id": "Q8K480", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K480#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 458, "start_aa": "Asn", "end_pos": 458, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn458", "evidence": [ { "id": "Q8K480", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K480#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Mfrp, a gene encoding a frizzled related protein, is mutated in the mouse retinal degeneration 6.", "journal": "Hum. Mol. Genet.", "date": "2002", "authors": "Kameya S, Hawes NL, Chang B, Heckenlively JR, Naggert JK, Nishina PM", "evidence": [ { "database": "UniProtKB", "id": "Q8K480", "url": "https://www.uniprot.org/uniprot/Q8K480" } ], "reference": [ { "type": "PubMed", "id": "12140190", "url": "https://glygen.org/publication/PubMed/12140190" } ] }, { "title": "Disease mechanisms in late-onset retinal macular degeneration associated with mutation in C1QTNF5.", "journal": "Human molecular genetics", "date": "2006", "authors": "Shu X, Tulloch B, Lennon A, Vlachantoni D, Zhou X, Hayward C, Wright AF", "evidence": [ { "database": "RefSeq", "id": "NP_001177242", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177242" } ], "reference": [ { "type": "PubMed", "id": "16600989", "url": "https://glygen.org/publication/PubMed/16600989" } ] }, { "title": "CTRP5 is a membrane-associated and secretory protein in the RPE and ciliary body and the S163R mutation of CTRP5 impairs its secretion.", "journal": "Investigative ophthalmology & visual science", "date": "2006", "authors": "Mandal MN, Vasireddy V, Reddy GB, Wang X, Moroi SE, Pattnaik BR, Hughes BA, Heckenlively JR, Hitchcock PF, Jablonski MM, Ayyagari R", "evidence": [ { "database": "RefSeq", "id": "NP_001177242", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177242" } ], "reference": [ { "type": "PubMed", "id": "17122142", "url": "https://glygen.org/publication/PubMed/17122142" } ] }, { "title": "Spatial and temporal expression of MFRP and its interaction with CTRP5.", "journal": "Invest. Ophthalmol. Vis. Sci.", "date": "2006", "authors": "Wang X., Heckenlively J.R., Ayyagari R., Reddy G.B., Jablonski M.M., Hughes B.A., Mandal M.N., Vasireddy V.", "evidence": [ { "database": "UniProtKB", "id": "Q8K480", "url": "https://www.uniprot.org/uniprot/Q8K480" } ], "reference": [ { "type": "PubMed", "id": "17122143", "url": "https://glygen.org/publication/PubMed/17122143" } ] }, { "title": "C1q/TNF-related protein 5 contributes to diabetic vascular endothelium dysfunction through promoting Nox-1 signaling.", "journal": "Redox biology", "date": "2020", "authors": "Liu J, Meng Z, Gan L, Guo R, Gao J, Liu C, Zhu D, Liu D, Zhang L, Zhang Z, Xie D, Jiao X, Lau WB, Lopez BL, Christopher TA, Ma X, Cao J, Wang Y", "evidence": [ { "database": "RefSeq", "id": "NP_001177242", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177242" } ], "reference": [ { "type": "PubMed", "id": "32122792", "url": "https://glygen.org/publication/PubMed/32122792" } ] }, { "title": "A Novel Mouse Model for Late-Onset Retinal Degeneration (L-ORD) Develops RPE Abnormalities Due to the Loss of C1qtnf5/Ctrp5.", "journal": "Advances in experimental medicine and biology", "date": "2023", "authors": "Borooah Shyamanga, Chekuri Anil, Pachauri Shikha, Sahu Bhubananda, Vorochikhina Marina, Suk John J, Bartsch Dirk-Uwe, Chavali Venkata R M, Jablonski Monica M, Ayyagari Radha", "evidence": [ { "database": "RefSeq", "id": "NP_001177242", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177242" } ], "reference": [ { "type": "PubMed", "id": "37440053", "url": "https://glygen.org/publication/PubMed/37440053" } ] } ], "pathway": [ { "id": "mmu:259172", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:259172", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZU82-1", "protein_name": "Membrane frizzled-related protein", "gene_name": "Mfrp", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKEYADVTLCPEAAELSKTEFCNPAFDLEAGPSCPPPALQKNVSSSLQGPWHVQRLRGLQPDCHFSGLCILLLSGLLLLLLGLLVAVILAQLQATSLPRTTKNPLPTRGGLTPTGVIPSTTPNTTTTTTTTPAITGRQEAAMSPTHQTTCGGLLPGPSGFFSSPNYPDLYPPHSHCVWHIQVATGQTIQLKIQVLSTESMLACLFDRLEISPAPTGPLLRMCGKTPPATVNTNTSHLRVSFVSDNDVEGSGFQAWYQAVAPGHWSCTHYEFHCDLLLCLKQDSVCDGIKDCIDGSDEANCSAKTLGCGGNLTELSGVFSTPNYPQHYPHQQLCTWYIKVPVGYRIRLEFHNFSLEEQTECKFDYVEVYEASNSGTFSSLGRFCGAEPPSHLVSSQHQLTVIFKTDLGISSGGFLATYQAINTTESGCPWADLCGPREFCQSRVRRELQRICDLWKDCANDSNDNCNSHLSPQLDLTCEPVQVEMCLGLSYNTTAFPNIWVGLATQMEVTDILRGYKSLTSLPCYQTFRRFLCGLLEPRCTSLGTILPPCRSVCQEAEQQCQSSLALLGIPWPFNCNRLPVPASLEACSQP", "length": 590 }, "evidence": [ { "id": "45239554", "url": "http://www.informatics.jax.org/homology/45239554", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9BY79-1", "protein_name": "Membrane frizzled-related protein", "gene_name": "MFRP", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKDFSDVILCMEATESSKTEFCNPAFEPESGPPCPPPVFPEDASYSVPAPWHGRRPRGLRPDCRFSWLCVLLLSSLLLLLLGLLVAIILAQLQAAPPSGASHSPLPAGGLTTTTTTPTITTSQAAGTPKGQQESGVSPSPQSTCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIESVASCLFDRLELSPEPEGPLLRVCGRVPPPTLNTNASHLLVVFVSDSSVEGFGFHAWYQAMAPGRGSCAHDEFRCDQLICLLPDSVCDGFANCADGSDETNCSAKFSGCGGNLTGLQGTFSTPSYLQQYPHQLLCTWHISVPAGHSIELQFHNFSLEAQDECKFDYVEVYETSSSGAFSLLGRFCGAEPPPHLVSSHHELAVLFRTDHGISSGGFSATYLAFNATENPCGPSELSCQAGGCKGVQWMCDMWRDCTDGSDDNCSGPLFPPPELACEPVQVEMCLGLSYNTTAFPNIWVGMITQEEVVEVLSGYKSLTSLPCYQHFRRLLCGLLVPRCTPLGSVLPPCRSVCQEAEHQCQSGLALLGTPWPFNCNRLPEAADLEACAQP", "length": 579 }, "evidence": [ { "id": "45239554", "url": "http://www.informatics.jax.org/homology/45239554", "database": "MGI" }, { "id": "Q8K480", "url": "https://omabrowser.org/oma/group/Q8K480/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q8K480", "url": "https://www.uniprot.org/uniprot/Q8K480" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "Q8K480", "url": "https://www.uniprot.org/uniprot/Q8K480" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q8K480", "url": "https://www.uniprot.org/uniprot/Q8K480" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "visual perception", "id": "GO:0007601", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007601", "evidence": [ { "database": "UniProtKB", "id": "Q8K480", "url": "https://www.uniprot.org/uniprot/Q8K480" } ], "pmid": "" }, { "name": "retina development in camera-type eye", "id": "GO:0060041", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060041", "evidence": [ { "database": "UniProtKB", "id": "Q8K480", "url": "https://www.uniprot.org/uniprot/Q8K480" } ], "pmid": "" }, { "name": "eye photoreceptor cell development", "id": "GO:0042462", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042462", "evidence": [ { "database": "UniProtKB", "id": "Q8K480", "url": "https://www.uniprot.org/uniprot/Q8K480" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 122, "end_pos": 124, "annotation": "n_glycosylation_sequon" }, { "start_pos": 233, "end_pos": 235, "annotation": "n_glycosylation_sequon" }, { "start_pos": 299, "end_pos": 301, "annotation": "n_glycosylation_sequon" }, { "start_pos": 310, "end_pos": 312, "annotation": "n_glycosylation_sequon" }, { "start_pos": 351, "end_pos": 353, "annotation": "n_glycosylation_sequon" }, { "start_pos": 421, "end_pos": 423, "annotation": "n_glycosylation_sequon" }, { "start_pos": 453, "end_pos": 455, "annotation": "n_glycosylation_sequon" }, { "start_pos": 458, "end_pos": 460, "annotation": "n_glycosylation_sequon" }, { "start_pos": 485, "end_pos": 487, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }