{ "uniprot_canonical_ac": "Q8K3I6-1", "uniprot_ac": "Q8K3I6", "uniprot_id": "IL27A_MOUSE", "mass": { "chemical_mass": 26542.0, "monoisotopic_mass": 26542.0 }, "refseq": { "ac": "NP_663611", "name": "interleukin-27 subunit alpha precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611" }, "gene_names": [ { "name": "Il27", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8K3I6", "id": "Q8K3I6" }, { "name": "IL-27; IL-27-A; IL-27p28; IL27-A; Il30; p28", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611", "id": "NP_663611" }, { "name": "Il27a", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q8K3I6", "id": "Q8K3I6" }, { "name": "Il27", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611", "id": "NP_663611" } ], "protein_names": [ { "name": "Interleukin-27 subunit alpha", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8K3I6" }, { "name": "IL-27 p28 subunit; interleukin-27 subunit alpha; interleukin 30; IL-27 subunit alpha", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611", "id": "NP_663611" }, { "name": "IL-27 subunit alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8K3I6" }, { "name": "IL-27-A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8K3I6" }, { "name": "IL27-A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8K3I6" }, { "name": "interleukin-27 subunit alpha precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611", "id": "NP_663611" }, { "name": "p28", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8K3I6" } ], "function": [ { "annotation": "Associates with EBI3 to form the IL-27 interleukin, a heterodimeric cytokine which functions in innate immunity. IL-27 has pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and that has diverse effects on innate immune cells. Among its target cells are CD4 T-helper cells which can differentiate in type 1 effector cells (TH1), type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon-gamma/IFN-gamma production of naive CD4 T-cells, binds to the cytokine receptor WSX-1/TCCR which appears to be required but not sufficient for IL-27-mediated signal transduction. IL-27 potentiate the early phase of TH1 response and suppress TH2 and TH17 differentiation. It induces the differentiation of TH1 cells via two distinct pathways, p38 MAPK/TBX21- and ICAM1/ITGAL/ERK-dependent pathways. It also induces STAT1, STAT3, STAT4 and STAT5 phosphorylation and activates TBX21/T-Bet via STAT1 with resulting IL12RB2 up-regulation, an event crucial to TH1 cell commitment. It suppresses the expression of GATA3, the inhibitor TH1 cells development. In CD8 T-cells, it activates STATs as well as GZMB. IL-27 reveals to be a potent inhibitor of TH17 cell development and of IL-17 production. Indeed IL27 alone is also able to inhibit the production of IL17 by CD4 and CD8 T-cells. While IL-27 suppressed the development of pro-inflammatory Th17 cells via STAT1, it inhibits the development of anti-inflammatory inducible regulatory T-cells, iTreg, independently of STAT1. IL-27 has also an effect on cytokine production, it suppresses pro-inflammatory cytokine production such as IL2, IL4, IL5 and IL6 and activates suppressors of cytokine signaling such as SOCS1 and SOCS3. Apart from suppression of cytokine production, IL-27 also antagonizes the effects of some cytokines such as IL6 through direct effects on T-cells. Another important role of IL-27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines such as IP-10/CXCL10 and MIG/CXCL9.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6#function" }, { "database": "PubMed", "id": "16365415", "url": "https://glygen.org/publication/PubMed/16365415" }, { "database": "PubMed", "id": "14657353", "url": "https://glygen.org/publication/PubMed/14657353" }, { "database": "PubMed", "id": "16906166", "url": "https://glygen.org/publication/PubMed/16906166" }, { "database": "PubMed", "id": "16493033", "url": "https://glygen.org/publication/PubMed/16493033" }, { "database": "PubMed", "id": "17114427", "url": "https://glygen.org/publication/PubMed/17114427" }, { "database": "PubMed", "id": "17549733", "url": "https://glygen.org/publication/PubMed/17549733" }, { "database": "PubMed", "id": "17015723", "url": "https://glygen.org/publication/PubMed/17015723" }, { "database": "PubMed", "id": "15688376", "url": "https://glygen.org/publication/PubMed/15688376" }, { "database": "PubMed", "id": "16751375", "url": "https://glygen.org/publication/PubMed/16751375" }, { "database": "PubMed", "id": "16034109", "url": "https://glygen.org/publication/PubMed/16034109" }, { "database": "PubMed", "id": "16906167", "url": "https://glygen.org/publication/PubMed/16906167" }, { "database": "PubMed", "id": "14565860", "url": "https://glygen.org/publication/PubMed/14565860" }, { "database": "PubMed", "id": "15585838", "url": "https://glygen.org/publication/PubMed/15585838" }, { "database": "PubMed", "id": "12121660", "url": "https://glygen.org/publication/PubMed/12121660" }, { "database": "PubMed", "id": "14871851", "url": "https://glygen.org/publication/PubMed/14871851" } ] }, { "annotation": "Externalized histones fuel pulmonary fibrosis via a platelet-macrophage circuit of TGFbeta1 and IL-27.", "evidence": [ { "database": "RefSeq", "id": "NP_663611", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611" }, { "database": "PubMed", "id": "37756334", "url": "https://glygen.org/publication/PubMed/37756334" } ] }, { "annotation": "IL-27 induces an IFN-like signature in murine macrophages which in turn modulate colonic epithelium. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_663611", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611" }, { "database": "PubMed", "id": "37153622", "url": "https://glygen.org/publication/PubMed/37153622" } ] }, { "annotation": "IL-27 induces autophagy through regulation of the DNMT1/lncRNA MEG3/ERK/p38 axis to reduce pulmonary fibrosis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_663611", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611" }, { "database": "PubMed", "id": "36869378", "url": "https://glygen.org/publication/PubMed/36869378" } ] }, { "annotation": "IL-27 regulates IL-12 responsiveness of naive CD4+ T cells through Stat1-dependent and -independent mechanisms", "evidence": [ { "database": "RefSeq", "id": "NP_663611", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611" }, { "database": "PubMed", "id": "14657353", "url": "https://glygen.org/publication/PubMed/14657353" } ] }, { "annotation": "IL-6 (gp130) family cytokine members include CLC/NNT1/BSF3 and IL-27 [review] Review article", "evidence": [ { "database": "RefSeq", "id": "NP_663611", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611" }, { "database": "PubMed", "id": "15253382", "url": "https://glygen.org/publication/PubMed/15253382" } ] }, { "annotation": "Inactivation of interleukin-30 in colon cancer stem cells via CRISPR/Cas9 genome editing inhibits their oncogenicity and improves host survival.", "evidence": [ { "database": "RefSeq", "id": "NP_663611", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611" }, { "database": "PubMed", "id": "36927528", "url": "https://glygen.org/publication/PubMed/36927528" } ] }, { "annotation": "Interleukin-27-dependent transcriptome signatures during neonatal sepsis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_663611", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611" }, { "database": "PubMed", "id": "36891292", "url": "https://glygen.org/publication/PubMed/36891292" } ] }, { "annotation": "The IL-27/WSX-1 signaling system is a key commitment step at which naive Th precursor cells commence differentiation into Th1 cells.", "evidence": [ { "database": "RefSeq", "id": "NP_663611", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611" }, { "database": "PubMed", "id": "12734330", "url": "https://glygen.org/publication/PubMed/12734330" } ] } ], "disease": [ { "disease_id": "DOID:106", "recommended_name": { "id": "DOID:106", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:106", "name": "pleural tuberculosis", "description": "An extrapulmonary tuberculosis that results_in lymphocyte-predominant exudative pleural effusion, located_in pleura. This results from an allergic response to tuberculoprotein causing the permeabiltity of the pleural vasculature to alter leading to a sub-pleural caseous focus rupture into the pleural sac." }, "synonyms": [ { "id": "DOID:106", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:106", "name": "Pearly disease", "description": "" }, { "id": "DOID:106", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:106", "name": "Tuberculosis of pleura", "description": "" }, { "id": "DOID:106", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:106", "name": "Tuberculous pleurisy", "description": "" }, { "id": "DOID:106", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:106", "name": "Tuberculous pleuritis", "description": "" }, { "id": "DOID:106", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:106", "name": "tuberculous pleurisy in primary progressive tuberculosis", "description": "" } ], "evidence": [ { "id": "106", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:106" } ] }, { "disease_id": "DOID:10887", "recommended_name": { "id": "DOID:10887", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10887", "name": "lepromatous leprosy", "description": "A leprosy that results in early cutaneous lesions which consist of pale macules that are small, diffuse, and symmetric. This form of leprosy is characterized by hypoesthesia over extensor surfaces of the distal extremities, alopecia affecting lateral aspects of the eyebrows, saddle-nose deformity and oral lepromas." }, "synonyms": [ { "id": "DOID:10887", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10887", "name": "type L leprosy", "description": "" } ], "evidence": [ { "id": "10887", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10887" } ] }, { "disease_id": "DOID:11123", "recommended_name": { "id": "DOID:11123", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11123", "name": "Henoch-Schoenlein purpura", "description": "A hypersensitivity vasculitis that is characterized by purpura (purplish plaques), arthralgia, gastrointestinal upset, and/or glomerulonephritis, and may be related to increased immune response following an infection." }, "synonyms": [ { "id": "DOID:11123", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11123", "name": "Allergic purpura", "description": "" }, { "id": "DOID:11123", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11123", "name": "Autoimmune purpura", "description": "" }, { "id": "DOID:11123", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11123", "name": "Henoch-Sch?nlein purpura", "description": "" }, { "id": "DOID:11123", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11123", "name": "Henoch-Sch@nlein purpura", "description": "" }, { "id": "DOID:11123", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11123", "name": "Henoch-Scholein purpura", "description": "" }, { "id": "DOID:11123", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11123", "name": "Henoch-Schonlein Purpura", "description": "" }, { "id": "DOID:11123", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11123", "name": "Purpura, autoimmune", "description": "" } ], "evidence": [ { "id": "11123", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11123" } ] }, { "disease_id": "DOID:1724", "recommended_name": { "id": "DOID:1724", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1724", "name": "duodenal ulcer", "description": "" }, "synonyms": [ { "id": "DOID:1724", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1724", "name": "Curling Ulcer", "description": "" }, { "id": "DOID:1724", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1724", "name": "Curling's ulcers", "description": "" }, { "id": "DOID:1724", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1724", "name": "Stress Ulcer", "description": "" } ], "evidence": [ { "id": "1724", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1724" } ] }, { "disease_id": "DOID:2043", "recommended_name": { "id": "DOID:2043", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2043", "name": "hepatitis B", "description": "A viral infectious disease that results_in inflammation located_in liver, has_material_basis_in Hepatitis B virus, which is transmitted_by sexual contact, blood transfusions, or fomites like needles or syringes. The infection has_symptom fever, fatigue, loss of appetite, nausea, vomiting, abdominal pain, clay-colored bowel movements, joint pain, and jaundice." }, "synonyms": [ { "id": "DOID:2043", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2043", "name": "chronic hepatitis B", "description": "" }, { "id": "DOID:2043", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2043", "name": "hepatitis B infection", "description": "" } ], "evidence": [ { "id": "2043", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2043" } ] }, { "disease_id": "DOID:2841", "recommended_name": { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "asthma", "description": "A bronchial disease that is characterized by chronic inflammation and narrowing of the airways, which is caused by a combination of environmental and genetic factors. The disease has_symptom recurring periods of wheezing (a whistling sound while breathing), has_symptom chest tightness, has_symptom shortness of breath, has_symptom mucus production and has_symptom coughing." }, "synonyms": [ { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "Exercise induced asthma", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "bronchial hyperreactivity", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma with acute exacerbation", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma with status asthmaticus", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "exercise-induced asthma", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "inherited susceptibility to asthma", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, nocturnal, susceptibility to", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, bronchial", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, diminished response to Antileukotriene treatment 1N", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, protection against", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, susceptibility to", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma-related traits, susceptibility to", "description": "" }, { "id": "MIM:600807", "resource": "MIM", "url": "https://www.omim.org/entry/600807", "name": "Asthma", "description": "Asthma" } ], "evidence": [ { "id": "2841", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2841" } ] }, { "disease_id": "DOID:2957", "recommended_name": { "id": "DOID:2957", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2957", "name": "pulmonary tuberculosis", "description": "A tuberculosis that is a contagious disease located_in lungs. The infection has_symptom fever, has_symptom cough, has_symptom difficulty in breathing, has_symptom inflammatory infiltrations, has_symptom formation of tubercles, has_symptom caseation, has_symptom pleural effusion, and has_symptom fibrosis." }, "synonyms": [], "evidence": [ { "id": "2957", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2957" } ] }, { "disease_id": "DOID:3083", "recommended_name": { "id": "DOID:3083", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3083", "name": "chronic obstructive pulmonary disease", "description": "An obstructive lung disease that is a chronic and progressive disorder of small airways in the lungs and that is characterized by irreversible airflow obstruction, typically identified by reductions in quantitative spirometric indices, induced forced expiratory volume at 1 second (FEV1) and the ratio of FEV1 to forced vital capacity (less than 0.7 is diagnostic of COPD). Lung volume is increased and pulmonary hypertension may occur. The pathologic changes result in the disruption of the airflow in the bronchial airways. Signs and symptoms include shortness of breath, wheezing, productive cough and chest tightness. COPD is a consequence (an end result) of chronic bronchitis, emphysema or both." }, "synonyms": [ { "id": "DOID:3083", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3083", "name": "COLD", "description": "" }, { "id": "DOID:3083", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3083", "name": "COPD", "description": "" }, { "id": "DOID:3083", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3083", "name": "chronic obstructive airway disease", "description": "" }, { "id": "DOID:3083", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3083", "name": "chronic obstructive lung disease", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "chronic obstructive pulmonary disease", "description": "A chronic and progressive lung disorder characterized by the loss of elasticity of the bronchial tree and the air sacs, destruction of the air sacs wall, thickening of the bronchial wall, and mucous accumulation in the bronchial tree. The pathologic changes result in the disruption of the air flow in the bronchial airways. Signs and symptoms include shortness of breath, wheezing, productive cough, and chest tightness. The two main types of chronic obstructive pulmonary disease are chronic obstructive bronchitis and emphysema." }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "COPD", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "COPD, chronic obstructive pulmonary disease", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "chronic obstructive airway disease", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "chronic obstructive airways disease", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "chronic obstructive lung disease", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "chronic obstructive pulmonary disease (COPD)", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "chronic obstructive pulmonary disease, (COPD)", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "cold", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "cold (chronic obstructive lung disease)", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "disease (COPD), chronic obstructive", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "obstructive lung disease, chronic", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "obstructive pulmonary disease (COPD), chronic", "description": "" }, { "id": "MONDO:0005002", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005002", "name": "pulmonary disease (COPD), chronic obstructive", "description": "" } ], "evidence": [ { "id": "3083", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3083" } ] }, { "disease_id": "DOID:321", "recommended_name": { "id": "DOID:321", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:321", "name": "tropical spastic paraparesis", "description": "A viral infectious disease that results in inflammation located in spinal cord, has_material_basis_in Human T-lymphotropic virus 1, which is transmitted by sexual contact, and transmitted by breast feeding. The infection has symptom spastic weakness of both legs, has symptom muscle stiffness, has symptom sensory disturbance, and has symptom spasms." }, "synonyms": [ { "id": "DOID:321", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:321", "name": "HTLV-associated myelopathy", "description": "" }, { "id": "DOID:321", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:321", "name": "Tropical spastic paralysis", "description": "" }, { "id": "DOID:321", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:321", "name": "Tropical spastic paraplegia", "description": "" }, { "id": "MONDO:0008039", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008039", "name": "tropical spastic paraparesis", "description": "Tropical spastic paraparesis is a chronic systemic immune-mediated inflammatory myeloneuropathy, more frequently reported in women than in men, that usually presents in adulthood with slowly progressive spastic paraparesis of the lower limbs, bladder and bowel dysfunction, and sensory disturbances in the lower extremities (e.g. paresthesia and dysesthesia) and that is associated with a human T-cell lymphotropic virus type 1 (HTLV-1) infection." }, { "id": "MONDO:0008039", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008039", "name": "HTLV-1-associated myelopathy/tropical spastic paraparesis", "description": "" }, { "id": "MONDO:0008039", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008039", "name": "HTLV-associated myelopathy", "description": "" }, { "id": "MONDO:0008039", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008039", "name": "Human T-lymphotropic virus type I-associated myelopathy/tropical spastic paraparesis", "description": "" }, { "id": "MONDO:0008039", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008039", "name": "Human T-lymphotropic virus type-1-associated myelopathy/tropical spastic paraparesis", "description": "" }, { "id": "MONDO:0008039", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008039", "name": "TSP", "description": "" }, { "id": "MONDO:0008039", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008039", "name": "ham/TSP", "description": "" }, { "id": "MONDO:0008039", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008039", "name": "tropical spastic paralysis", "description": "" }, { "id": "MONDO:0008039", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008039", "name": "tropical spastic paraplegia", "description": "" }, { "id": "MONDO:0008039", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008039", "name": "HTLV-1 associated myelopathy/tropical spastic paraparesis", "description": "" }, { "id": "MONDO:0008039", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008039", "name": "Human T-cell leukaemia virus type 1 associated myelopathy/tropical spastic paraparesis", "description": "" }, { "id": "MONDO:0008039", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008039", "name": "Human T-cell leukemia virus type 1 associated myelopathy/tropical spastic paraparesis", "description": "" }, { "id": "MONDO:0008039", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008039", "name": "familial spastic paraparesis, HTLV-1-associated", "description": "" }, { "id": "MONDO:0008039", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008039", "name": "ham", "description": "" }, { "id": "MONDO:0008039", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008039", "name": "myelopathy, HTLV-1-associated", "description": "" }, { "id": "MONDO:0008039", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008039", "name": "tropical spastic paraparesis (formerly)", "description": "" } ], "evidence": [ { "id": "321", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:321" } ] }, { "disease_id": "DOID:399", "recommended_name": { "id": "DOID:399", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:399", "name": "tuberculosis", "description": "A primary bacterial infectious disease that is located_in lungs, located_in lymph nodes, located_in pericardium, located_in brain, located_in pleura or located_in gastrointestinal tract, has_material_basis_in Mycobacterium tuberculosis, which is transmitted_by droplets released into the air when an infected person coughs or sneezes." }, "synonyms": [], "evidence": [ { "id": "399", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:399" } ] }, { "disease_id": "DOID:418", "recommended_name": { "id": "DOID:418", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:418", "name": "systemic scleroderma", "description": "A scleroderma that is characterized by fibrosis (or hardening) of the skin and major organs, as well as vascular alterations, and autoantibodies." }, "synonyms": [ { "id": "DOID:418", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:418", "name": "Scleroderma", "description": "" }, { "id": "DOID:418", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:418", "name": "Scleroderma syndrome", "description": "" }, { "id": "DOID:418", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:418", "name": "progressive systemic sclerosis", "description": "" }, { "id": "DOID:418", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:418", "name": "systemic sclerosis", "description": "" }, { "id": "MONDO:0008418", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008418", "name": "scleroderma, familial progressive", "description": "" }, { "id": "MONDO:0008418", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008418", "name": "scleroderma, familial progressive", "description": "" }, { "id": "MONDO:0008418", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008418", "name": "Crest syndrome", "description": "" }, { "id": "MONDO:0008418", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008418", "name": "systemic sclerosis, susceptibility to", "description": "" } ], "evidence": [ { "id": "418", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:418" } ] }, { "disease_id": "DOID:5082", "recommended_name": { "id": "DOID:5082", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5082", "name": "liver cirrhosis", "description": "" }, "synonyms": [ { "id": "DOID:5082", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5082", "name": "Cirrhosis", "description": "" }, { "id": "DOID:5082", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5082", "name": "cirrhosis of liver", "description": "" }, { "id": "MONDO:0005155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005155", "name": "cirrhosis of liver", "description": "A disorder characterized by replacement of the liver parenchyma with fibrous tissue and regenerative nodules. It is usually caused by alcoholism, hepatitis B, and hepatitis C. Complications include the development of ascites, esophageal varices, bleeding, and hepatic encephalopathy." }, { "id": "MONDO:0005155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005155", "name": "cirrhosis", "description": "" }, { "id": "MONDO:0005155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005155", "name": "cirrhosis of liver", "description": "" }, { "id": "MONDO:0005155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005155", "name": "liver cirrhosis", "description": "" } ], "evidence": [ { "id": "5082", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5082" } ] }, { "disease_id": "DOID:526", "recommended_name": { "id": "DOID:526", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:526", "name": "human immunodeficiency virus infectious disease", "description": "A viral infectious disease that results in destruction of immune system, leading to life-threatening opportunistic infections and cancers, has_material_basis_in Human immunodeficiency virus 1 or has_material_basis_in Human immunodeficiency virus 2, which are transmitted by sexual contact, transmitted by transfer of blood, semen, vaginal fluid, pre-ejaculate, or breast milk, transmitted by congenital method, and transmitted by contaminated needles. The virus infects helper T cells (CD4+ T cells) which are directly or indirectly destroyed, macrophages, and dendritic cells. The infection has symptom diarrhea, has symptom fatigue, has symptom fever, has symptom vaginal yeast infection, has symptom headache, has symptom mouth sores, has symptom muscle aches, has symptom sore throat, and has symptom swollen lymph glands." }, "synonyms": [ { "id": "DOID:526", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:526", "name": "HIV infection", "description": "" } ], "evidence": [ { "id": "526", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:526" } ] }, { "disease_id": "DOID:750", "recommended_name": { "id": "DOID:750", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:750", "name": "peptic ulcer disease", "description": "" }, "synonyms": [ { "id": "DOID:750", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:750", "name": "acute peptic ulcer with hemorrhage", "description": "" }, { "id": "DOID:750", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:750", "name": "acute peptic ulcer with hemorrhage and perforation", "description": "" }, { "id": "DOID:750", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:750", "name": "acute peptic ulcer without hemorrhage and without perforation", "description": "" } ], "evidence": [ { "id": "750", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:750" } ] }, { "disease_id": "DOID:8515", "recommended_name": { "id": "DOID:8515", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8515", "name": "Cor pulmonale", "description": "A congestive heart failure that involves a failure of the right side of the heart and is characterized by an enlargement of the right ventricle of the heart as a response to increased resistance or high blood pressure in the lungs." }, "synonyms": [ { "id": "DOID:8515", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8515", "name": "cardiopulmonary disease", "description": "" }, { "id": "DOID:8515", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8515", "name": "pulmonary heart disease", "description": "" } ], "evidence": [ { "id": "8515", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:8515" } ] }, { "disease_id": "DOID:8568", "recommended_name": { "id": "DOID:8568", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8568", "name": "infectious mononucleosis", "description": "A viral infectious disease that results in inflammation, located in pharynx, has_material_basis_in Human herpesvirus 4 and has symptom fever, has symptom fatigue, has symptom lymphadenopathy, and has symptom splenomegaly." }, "synonyms": [ { "id": "DOID:8568", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8568", "name": "Filatov's disease", "description": "" }, { "id": "DOID:8568", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8568", "name": "Gammaherpesviral mononucleosis", "description": "" }, { "id": "DOID:8568", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8568", "name": "Monocytic angina", "description": "" }, { "id": "DOID:8568", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8568", "name": "Pfeiffer's disease", "description": "" }, { "id": "DOID:8568", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8568", "name": "glandular fever", "description": "" }, { "id": "DOID:8568", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8568", "name": "mononucleosis", "description": "" } ], "evidence": [ { "id": "8568", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:8568" } ] } ], "snv": [ { "evidence": [ { "id": "rs259650924", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs259650924" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 157, "end_pos": 157, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KCS->NCS).", "chr_id": "7", "chr_pos": "126188701", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K157", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Il27", "url": "https://www.uniprot.org/uniprot/Q8K3I6", "locus": { "chromosome": "7", "start_pos": 126188182, "end_pos": 126194113, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000044701", "url": "https://www.ensembl.org/id/ENSMUSG00000044701" } ] } } ], "crossref": [ { "id": "ENSMUSG00000044701", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000044701", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "246779", "url": "https://www.ncbi.nlm.nih.gov/gene/246779", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q8K3I6", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q8K3I6*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR009079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR026207", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026207", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:246779", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:246779", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2384409", "url": "http://www.informatics.jax.org/marker/MGI:2384409", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "LCFLSMM", "url": "https://omabrowser.org/oma/group/LCFLSMM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4628116at2759", "url": "http://www.orthodb.org/?query=4628116at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR20879", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20879", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR20879:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20879:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "7Z0L", "url": "https://www.rcsb.org/structure/7Z0L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ZG0", "url": "https://www.rcsb.org/structure/7ZG0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PR_Q8K3I6", "url": "http://purl.obolibrary.org/obo/PR_Q8K3I6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-9020956", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9020956", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_663611", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8K3I6-1", "url": "https://www.uniprot.org/uniprot/Q8K3I6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGQVTGDLGWRLSLLLLPLLLVQAGSWGFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS", "length": 234, "header": "sp|Q8K3I6-1|IL27A_MOUSE Isoform 1 of Interleukin-27 subunit alpha OS=Mus musculus OX=10090 GN=Il27 PE=1 SV=1 CANONICAL=Q8K3I6-1" }, "isoforms": [ { "isoform_ac": "Q8K3I6-1", "url": "", "sequence": { "sequence": "MGQVTGDLGWRLSLLLLPLLLVQAGSWGFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS", "length": 234, "header": "sp|Q8K3I6-1|IL27A_MOUSE Isoform 1 of Interleukin-27 subunit alpha OS=Mus musculus OX=10090 GN=Il27 PE=1 SV=1 CANONICAL=Q8K3I6-1" }, "locus": { "chromosome": "7", "start_pos": 126194082, "end_pos": 126188470, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000058429", "url": "https://www.ensembl.org/id/ENSMUST00000058429" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000054637", "url": "https://www.ensembl.org/id/ENSMUSP00000054637" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 85, "start_aa": "Asn", "end_pos": 85, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn85", "evidence": [ { "id": "Q8K3I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K3I6#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "IL-27, a heterodimeric cytokine composed of EBI3 and p28 protein, induces proliferation of naive CD4(+) T cells.", "journal": "Immunity", "date": "2002", "authors": "Pflanz S, Timans JC, Cheung J, Rosales R, Kanzler H, Gilbert J, Hibbert L, Churakova T, Travis M, Vaisberg E, Blumenschein WM, Mattson JD, Wagner JL, To W, Zurawski S, McClanahan TK, Gorman DM, Bazan JF, de Waal Malefyt R, Rennick D, Kastelein RA", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "12121660", "url": "https://glygen.org/publication/PubMed/12121660" } ] }, { "title": "Cutting edge: role of IL-27/WSX-1 signaling for induction of T-bet through activation of STAT1 during initial Th1 commitment.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Takeda A, Hamano S, Yamanaka A, Hanada T, Ishibashi T, Mak TW, Yoshimura A, Yoshida H", "evidence": [ { "database": "RefSeq", "id": "NP_663611", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611" } ], "reference": [ { "type": "PubMed", "id": "12734330", "url": "https://glygen.org/publication/PubMed/12734330" } ] }, { "title": "IL-27 and IFN-alpha signal via Stat1 and Stat3 and induce T-Bet and IL-12Rbeta2 in naive T cells.", "journal": "J. Interferon Cytokine Res.", "date": "2003", "authors": "Hibbert L, Pflanz S, De Waal Malefyt R, Kastelein RA", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "14565860", "url": "https://glygen.org/publication/PubMed/14565860" } ] }, { "title": "IL-27 regulates IL-12 responsiveness of naive CD4+ T cells through Stat1-dependent and -independent mechanisms.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2003", "authors": "Lucas S, Ghilardi N, Li J, de Sauvage FJ", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" }, { "database": "RefSeq", "id": "NP_663611", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611" } ], "reference": [ { "type": "PubMed", "id": "14657353", "url": "https://glygen.org/publication/PubMed/14657353" } ] }, { "title": "Potent antitumor activity of interleukin-27.", "journal": "Cancer Res.", "date": "2004", "authors": "Aoki T., Yoshimoto T., Koyanagi Y., Fujita K., Belladonna M.L., Hisada M., Kamiya S., Mizuguchi J.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "14871851", "url": "https://glygen.org/publication/PubMed/14871851" } ] }, { "title": "New IL-6 (gp130) family cytokine members, CLC/NNT1/BSF3 and IL-27.", "journal": "Growth factors (Chur, Switzerland)", "date": "2004", "authors": "Murakami M, Kamimura D, Hirano T", "evidence": [ { "database": "RefSeq", "id": "NP_663611", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611" } ], "reference": [ { "type": "PubMed", "id": "15253382", "url": "https://glygen.org/publication/PubMed/15253382" } ] }, { "title": "IL-27 mediates complete regression of orthotopic primary and metastatic murine neuroblastoma tumors: role for CD8+ T cells.", "journal": "J. Immunol.", "date": "2004", "authors": "Hahn C., Salcedo R., Kastelein R., Stauffer J.K., Back T.C., Hixon J.A., Lincoln E., Malyguine A., Shafer-Weaver K., Wigginton J.M.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "15585838", "url": "https://glygen.org/publication/PubMed/15585838" } ] }, { "title": "Expression of IL-27 in murine carcinoma cells produces antitumor effects and induces protective immunity in inoculated host animals.", "journal": "Int. J. Cancer", "date": "2005", "authors": "Yu L., Fujisawa T., Tagawa M., Kawamura K., Shimozato O., Iizasa T., Chiyo M.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "15688376", "url": "https://glygen.org/publication/PubMed/15688376" } ] }, { "title": "Production of IL-27 and other IL-12 family cytokines by microglia and their subpopulations.", "journal": "Brain Res.", "date": "2005", "authors": "Mizuno T., Takeuchi H., Kawanokuchi J., Sonobe Y., Suzumura A., Yawata I.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "15804443", "url": "https://glygen.org/publication/PubMed/15804443" } ] }, { "title": "Augmentation of effector CD8+ T cell generation with enhanced granzyme B expression by IL-27.", "journal": "J. Immunol.", "date": "2005", "authors": "Yoshimoto T., Asakawa M., Kamiya S., Mizuguchi J., Morishima N., Owaki T.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "16034109", "url": "https://glygen.org/publication/PubMed/16034109" } ] }, { "title": "IL-27 limits IL-2 production during Th1 differentiation.", "journal": "J. Immunol.", "date": "2006", "authors": "Kastelein R.A., de Sauvage F.J., Hunter C.A., Villarino A.V., Saris C.J.M., Stumhofer J.S.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "16365415", "url": "https://glygen.org/publication/PubMed/16365415" } ] }, { "title": "IL-27 suppresses CD28-mediated IL-2 production through suppressor of cytokine signaling 3.", "journal": "J. Immunol.", "date": "2006", "authors": "Takeda K., Yoshimoto T., Asakawa M., Fukai F., Kamiya S., Mizuguchi J., Owaki T.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "16493033", "url": "https://glygen.org/publication/PubMed/16493033" } ] }, { "title": "Antiangiogenic and antitumor activities of IL-27.", "journal": "J. Immunol.", "date": "2006", "authors": "Shimizu M., Shimamura M., Yoshimoto T., Takeda Y., Luster A.D., Fujita K., Iwakura Y., Kudo M., Asakawa M., Mizuguchi J., Owaki T.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "16751375", "url": "https://glygen.org/publication/PubMed/16751375" } ] }, { "title": "Interleukin 27 negatively regulates the development of interleukin 17-producing T helper cells during chronic inflammation of the central nervous system.", "journal": "Nat. Immunol.", "date": "2006", "authors": "Huang Q., Huang E., Yoshimura A., Hennighausen L., O'Shea J.J., Hunter C.A., Ernst M., Laurence A., Tato C.M., Villarino A.V., Saris C.J.M., Johnson L.M., Sehy D., Stumhofer J.S., Wilson E.H.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "16906166", "url": "https://glygen.org/publication/PubMed/16906166" } ] }, { "title": "Interleukin 27 limits autoimmune encephalomyelitis by suppressing the development of interleukin 17-producing T cells.", "journal": "Nat. Immunol.", "date": "2006", "authors": "Batten M., Lee J., Li J., Yi S., Lucas S., Danilenko D.M., de Sauvage F.J., Ghilardi N., Kljavin N.M.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "16906167", "url": "https://glygen.org/publication/PubMed/16906167" } ] }, { "title": "Two-sided roles of IL-27: induction of Th1 differentiation on naive CD4+ T cells versus suppression of proinflammatory cytokine production including IL-23-induced IL-17 on activated CD4+ T cells partially through STAT3-dependent mechanism.", "journal": "J. Immunol.", "date": "2006", "authors": "Hamano S., Ishibashi T., Yoshida H., Miyazaki Y., Yoshimura T., Yoshimura A., Takeda A., Kinjyo I.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "17015723", "url": "https://glygen.org/publication/PubMed/17015723" } ] }, { "title": "IL-27 induces Th1 differentiation via p38 MAPK/T-bet- and intercellular adhesion molecule-1/LFA-1/ERK1/2-dependent pathways.", "journal": "J. Immunol.", "date": "2006", "authors": "Yoshimoto T., Asakawa M., Fukai F., Mizuguchi J., Owaki T.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "17114427", "url": "https://glygen.org/publication/PubMed/17114427" } ] }, { "title": "The biology and therapeutic potential of interleukin 27.", "journal": "J. Mol. Med.", "date": "2007", "authors": "Batten M., Ghilardi N.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "17294231", "url": "https://glygen.org/publication/PubMed/17294231" } ] }, { "title": "IL-27 synthesis induced by TLR ligation critically depends on IFN regulatory factor 3.", "journal": "J. Immunol.", "date": "2007", "authors": "Nguyen M., Goriely S., Willems F., Goldman M., De Wit D., Trottein F., Flamand V., Molle C., Renneson J.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "17548596", "url": "https://glygen.org/publication/PubMed/17548596" } ] }, { "title": "IL-27 controls the development of inducible regulatory T cells and Th17 cells via differential effects on STAT1.", "journal": "Eur. J. Immunol.", "date": "2007", "authors": "Becker C., Galle P.R., Neurath M.F., Wirtz S., Fantini M.C., Neufert C., Weigmann B.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "17549733", "url": "https://glygen.org/publication/PubMed/17549733" } ] }, { "title": "Suppressive effect of IL-27 on encephalitogenic Th17 cells and the effector phase of experimental autoimmune encephalomyelitis.", "journal": "J. Immunol.", "date": "2007", "authors": "Ciric B., Das Sarma J., Fitzgerald D.C., Grammatikopolou J., Gran B., Harle H., Rostami A., Touil T., Zhang G.-X.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "17709543", "url": "https://glygen.org/publication/PubMed/17709543" } ] }, { "title": "Peroxisome proliferator-activated receptor-alpha agonist fenofibrate regulates IL-12 family cytokine expression in the CNS: relevance to multiple sclerosis.", "journal": "J. Neurochem.", "date": "2007", "authors": "Xu J., Drew P.D., Racke M.K.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "reference": [ { "type": "PubMed", "id": "17727629", "url": "https://glygen.org/publication/PubMed/17727629" } ] }, { "title": "IL-27 induces autophagy through regulation of the DNMT1/lncRNA MEG3/ERK/p38 axis to reduce pulmonary fibrosis.", "journal": "Respiratory research", "date": "2023-03-03", "authors": "Ting Li, Feng Yingying, Zhou Ying, Tong Zhongkai, Dong Zhaoxing", "evidence": [ { "database": "RefSeq", "id": "NP_663611", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611" } ], "reference": [ { "type": "PubMed", "id": "36869378", "url": "https://glygen.org/publication/PubMed/36869378" } ] }, { "title": "Interleukin-27-dependent transcriptome signatures during neonatal sepsis.", "journal": "Frontiers in immunology", "date": "2023", "authors": "Povroznik Jessica M, Akhter Halima, Vance Jordan K, Annamanedi Madhavi, Dziadowicz Sebastian A, Wang Lei, Divens Ashley M, Hu Gangqing, Robinson Cory M", "evidence": [ { "database": "RefSeq", "id": "NP_663611", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611" } ], "reference": [ { "type": "PubMed", "id": "36891292", "url": "https://glygen.org/publication/PubMed/36891292" } ] }, { "title": "Inactivation of interleukin-30 in colon cancer stem cells via CRISPR/Cas9 genome editing inhibits their oncogenicity and improves host survival.", "journal": "Journal for immunotherapy of cancer", "date": "2023-03", "authors": "D'Antonio Luigi, Fieni Cristiano, Ciummo Stefania Livia, Vespa Simone, Lotti Lavinia, Sorrentino Carlo, Di Carlo Emma", "evidence": [ { "database": "RefSeq", "id": "NP_663611", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611" } ], "reference": [ { "type": "PubMed", "id": "36927528", "url": "https://glygen.org/publication/PubMed/36927528" } ] }, { "title": "IL-27 induces an IFN-like signature in murine macrophages which in turn modulate colonic epithelium.", "journal": "Frontiers in immunology", "date": "2023", "authors": "Andrews Caroline, McLean Mairi H, Hixon Julie A, Pontejo Sergio M, Starr Tregei, Malo Courtney, Cam Margaret, Ridnour Lisa, Hickman Heather, Steele-Mortimer Olivia, Wink David A, Young Howard A, McVicar Daniel W, Li Wenqing, Durum Scott K", "evidence": [ { "database": "RefSeq", "id": "NP_663611", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611" } ], "reference": [ { "type": "PubMed", "id": "37153622", "url": "https://glygen.org/publication/PubMed/37153622" } ] }, { "title": "Externalized histones fuel pulmonary fibrosis via a platelet-macrophage circuit of TGF\u03b21 and IL-27.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2023-10-03", "authors": "Riehl Dennis R, Sharma Arjun, Roewe Julian, Murke Florian, Ruppert Clemens, Eming Sabine A, Bopp Tobias, Kleinert Hartmut, Radsak Markus P, Colucci Giuseppe, Subramaniam Saravanan, Reinhardt Christoph, Giebel Bernd, Prinz Immo, Guenther Andreas, Strand Dennis, Gunzer Matthias, Waisman Ari, Ward Peter A, Ruf Wolfram, Sch\u00e4fer Katrin, Bosmann Markus", "evidence": [ { "database": "RefSeq", "id": "NP_663611", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_663611" } ], "reference": [ { "type": "PubMed", "id": "37756334", "url": "https://glygen.org/publication/PubMed/37756334" } ] } ], "pathway": [ { "id": "mmu:246779", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:246779", "resource": "KEGG Pathway" }, { "id": "R-MMU-9020956", "name": "Interleukin-27 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9020956", "resource": "Reactome", "description": "Interleukin-27 signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8NEV9-1", "protein_name": "Interleukin-27 subunit alpha", "gene_name": "IL27", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGQTAGDLGWRLSLLLLPLLLVQAGVWGFPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAESHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALLGGLGTQGRWTNMERMQLWAMRLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP", "length": 243 }, "evidence": [ { "id": "45241606", "url": "http://www.informatics.jax.org/homology/45241606", "database": "MGI" }, { "id": "Q8K3I6", "url": "https://omabrowser.org/oma/group/Q8K3I6/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "interleukin-27 receptor binding", "id": "GO:0045523", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045523", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "pmid": "" }, { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "pmid": "" }, { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "regulation of T-helper 1 cell differentiation", "id": "GO:0045625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045625", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "pmid": "" }, { "name": "positive regulation of defense response to virus by host", "id": "GO:0002230", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002230", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "pmid": "" }, { "name": "positive regulation of type II interferon production", "id": "GO:0032729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032729", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "pmid": "" }, { "name": "regulation of T cell proliferation", "id": "GO:0042129", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042129", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "pmid": "" }, { "name": "response to Gram-positive bacterium", "id": "GO:0140459", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140459", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "Q8K3I6", "url": "https://www.uniprot.org/uniprot/Q8K3I6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 85, "end_pos": 87, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 27 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }