{ "uniprot_canonical_ac": "Q8K3A6-1", "uniprot_ac": "Q8K3A6", "uniprot_id": "ARMX6_MOUSE", "mass": { "chemical_mass": 33321.0, "monoisotopic_mass": 33321.0 }, "refseq": { "ac": "NP_001007579", "name": "protein ARMCX6", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007579" }, "gene_names": [ { "name": "Armcx6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8K3A6", "id": "Q8K3A6" }, { "name": "Armcx6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007579", "id": "NP_001007579" } ], "protein_names": [ { "name": "Protein ARMCX6", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8K3A6" }, { "name": "protein ARMCX6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007579", "id": "NP_001007579" } ], "function": [ { "annotation": "May regulate the dynamics and distribution of mitochondria in neural cells.", "evidence": [ { "database": "UniProtKB", "id": "Q8K3A6", "url": "https://www.uniprot.org/uniprot/Q8K3A6#function" }, { "database": "PubMed", "id": "22569362", "url": "https://glygen.org/publication/PubMed/22569362" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8K3A6", "url": "https://www.uniprot.org/uniprot/Q8K3A6" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Armcx6", "url": "https://www.uniprot.org/uniprot/Q8K3A6", "locus": { "chromosome": "X", "start_pos": 133649210, "end_pos": 133652166, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000050394", "url": "https://www.ensembl.org/id/ENSMUSG00000050394" } ] } } ], "crossref": [ { "id": "ENSMUSG00000050394", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000050394", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "278097", "url": "https://www.ncbi.nlm.nih.gov/gene/278097", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR006911", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006911", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:278097", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:278097", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2147993", "url": "http://www.informatics.jax.org/marker/MGI:2147993", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "FIQGKMW", "url": "https://omabrowser.org/oma/group/FIQGKMW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5262111at2759", "url": "http://www.orthodb.org/?query=5262111at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15712", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15712", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15712:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15712:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04826", "url": "http://pfam.xfam.org/family/PF04826", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8K3A6", "url": "http://purl.obolibrary.org/obo/PR_Q8K3A6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001007579", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007579", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q8K3A6", "url": "https://www.uniprot.org/uniprot/Q8K3A6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8K3A6-1", "url": "https://www.uniprot.org/uniprot/Q8K3A6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGRAREMGWMAAGLMIGAGACYCMYKLTMGRSEGNELEDEEEDEWEDGQDLDEEEADNWFDFTAMARPWSEDGDWDEPGAPGGTEDRRSGGGKANRAHPIKQRPFPYEHKNIWGEQSFKSFTCILDLNKCVSTQRKKRFTKNINAGFSLSPNISKHLASLSVVGNRSPTPHPTVREKALFVPENPNSSLENQGQIKMSIDEVCRETLLCCCKSFLQQAGLSLLISMTVINNMLAKSVSDLKFPLLSKGSGCAEVRGLEELMSLSEKPVLVGEALAAQMLSSFMCLFTRSGSREMLVEAISP", "length": 301, "header": "sp|Q8K3A6-1|ARMX6_MOUSE Isoform 1 of Protein ARMCX6 OS=Mus musculus OX=10090 GN=Armcx6 PE=2 SV=1 CANONICAL=Q8K3A6-1" }, "isoforms": [ { "isoform_ac": "Q8K3A6-1", "url": "", "sequence": { "sequence": "MGRAREMGWMAAGLMIGAGACYCMYKLTMGRSEGNELEDEEEDEWEDGQDLDEEEADNWFDFTAMARPWSEDGDWDEPGAPGGTEDRRSGGGKANRAHPIKQRPFPYEHKNIWGEQSFKSFTCILDLNKCVSTQRKKRFTKNINAGFSLSPNISKHLASLSVVGNRSPTPHPTVREKALFVPENPNSSLENQGQIKMSIDEVCRETLLCCCKSFLQQAGLSLLISMTVINNMLAKSVSDLKFPLLSKGSGCAEVRGLEELMSLSEKPVLVGEALAAQMLSSFMCLFTRSGSREMLVEAISP", "length": 301, "header": "sp|Q8K3A6-1|ARMX6_MOUSE Isoform 1 of Protein ARMCX6 OS=Mus musculus OX=10090 GN=Armcx6 PE=2 SV=1 CANONICAL=Q8K3A6-1" }, "locus": { "chromosome": "X", "start_pos": 133650829, "end_pos": 133649927, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000052431", "url": "https://www.ensembl.org/id/ENSMUST00000052431" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000057277", "url": "https://www.ensembl.org/id/ENSMUSP00000057277" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The eutherian Armcx genes regulate mitochondrial trafficking in neurons and interact with Miro and Trak2.", "journal": "Nat. Commun.", "date": "2012", "authors": "Lopez-Domenech G, Serrat R, Mirra S, D'Aniello S, Somorjai I, Abad A, Vitureira N, Garcia-Arumi E, Alonso MT, Rodriguez-Prados M, Burgaya F, Andreu AL, Garcia-Sancho J, Trullas R, Garcia-Fernandez J, Soriano E", "evidence": [ { "database": "UniProtKB", "id": "Q8K3A6", "url": "https://www.uniprot.org/uniprot/Q8K3A6" } ], "reference": [ { "type": "PubMed", "id": "22569362", "url": "https://glygen.org/publication/PubMed/22569362" } ] } ], "pathway": [ { "id": "mmu:278097", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:278097", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q66HF0-1", "protein_name": "Protein ARMCX6", "gene_name": "Armcx6", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGRAREMGWMAAGLMIGAGACYCMYKLTMGRDEGNELENEEEDEWDDEQDLDEEEADIWFDFTAMARPWSEDGEWDEPGAPGGTEDRRSGGGKANRAHPTKQRPFPYEHKNIWGVQSFQTFPCALNLTKCAFSQGKKMFTESTIAGFSLTHNVSRHLSSLSVVGSRSPTPQPTVREKALDVPEHPNSSIENQDQIKMYIDEVCRDAVFCCCKSFLQQAGLGLLISMTVINNMLAKSLSDPKFPLLSEGSGCAKVQGLEAQMSLPEKPVLAEEVLAAQMLFSFMCLFTRSGSREMLVEAISP", "length": 301 }, "evidence": [ { "id": "45240397", "url": "http://www.informatics.jax.org/homology/45240397", "database": "MGI" }, { "id": "Q8K3A6", "url": "https://omabrowser.org/oma/group/Q8K3A6/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q7L4S7-1", "protein_name": "Protein ARMCX6", "gene_name": "ARMCX6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGRAREVGWMAAGLMIGAGACYCVYKLTIGRDDSEKLEEEGEEEWDDDQELDEEEPDIWFDFETMARPWTEDGDWTEPGAPGGTEDRPSGGGKANRAHPIKQRPFPYEHKNTWSAQNCKNGSCVLDLSKCLFIQGKLLFAEPKDAGFPFSQDINSHLASLSMARNTSPTPDPTVREALCAPDNLNASIESQGQIKMYINEVCRETVSRCCNSFLQQAGLNLLISMTVINNMLAKSASDLKFPLISEGSGCAKVQVLKPLMGLSEKPVLAGELVGAQMLFSFMSLFIRNGNREILLETPAP", "length": 300 }, "evidence": [ { "id": "45240397", "url": "http://www.informatics.jax.org/homology/45240397", "database": "MGI" }, { "id": "Q8K3A6", "url": "https://omabrowser.org/oma/group/Q8K3A6/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q8K3A6", "url": "https://www.uniprot.org/uniprot/Q8K3A6" } ], "pmid": "" }, { "name": "mitochondrial outer membrane", "id": "GO:0005741", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005741", "evidence": [ { "database": "UniProtKB", "id": "Q8K3A6", "url": "https://www.uniprot.org/uniprot/Q8K3A6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 152, "end_pos": 154, "annotation": "n_glycosylation_sequon" }, { "start_pos": 165, "end_pos": 167, "annotation": "n_glycosylation_sequon" }, { "start_pos": 186, "end_pos": 188, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }