{ "uniprot_canonical_ac": "Q8K354-1", "uniprot_ac": "Q8K354", "uniprot_id": "CBR3_MOUSE", "mass": { "chemical_mass": 30953.0, "monoisotopic_mass": 30953.0 }, "refseq": { "ac": "NP_766635", "name": "carbonyl reductase [NADPH] 3", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766635" }, "gene_names": [ { "name": "Cbr3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8K354", "id": "Q8K354" }, { "name": "1110001J05Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766635", "id": "NP_766635" }, { "name": "Cbr3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766635", "id": "NP_766635" } ], "protein_names": [ { "name": "Carbonyl reductase [NADPH] 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8K354" }, { "name": "1.1.1.184", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8K354" }, { "name": "1.6.5.10", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8K354" }, { "name": "NADPH-dependent carbonyl reductase 3; quinone reductase CBR3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766635", "id": "NP_766635" }, { "name": "NADPH-dependent carbonyl reductase 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8K354" }, { "name": "Quinone reductase CBR3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8K354" }, { "name": "carbonyl reductase [NADPH] 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766635", "id": "NP_766635" } ], "function": [ { "annotation": "Catalyzes the NADPH-dependent reduction of carbonyl compounds to their corresponding alcohols. Has low NADPH-dependent oxidoreductase activity. Acts on several orthoquinones, acts as well on non-quinone compounds, such as isatin or on the anticancer drug oracin. Best substrates for CBR3 is 1,2- naphthoquinone, hence could play a role in protection against cytotoxicity of exogenous quinones. Exerts activity toward ortho-quinones but not paraquinones. No endogenous substrate for CBR3 except isatin has been identified.", "evidence": [ { "database": "UniProtKB", "id": "Q8K354", "url": "https://www.uniprot.org/uniprot/Q8K354#function" }, { "database": "UniProtKB", "id": "O75828", "url": "https://www.uniprot.org/uniprot/O75828#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8K354", "url": "https://www.uniprot.org/uniprot/Q8K354" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Cbr3", "url": "https://www.uniprot.org/uniprot/Q8K354", "locus": { "chromosome": "16", "start_pos": 93487878, "end_pos": 93480103, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000022947", "url": "https://www.ensembl.org/id/ENSMUSG00000022947" } ] } } ], "crossref": [ { "id": "ENSMUSG00000022947", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000022947", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "1.1.1.184", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.1.1.184&UniProtAcc=Q8K354", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd05324", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05324", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "109857", "url": "https://www.ncbi.nlm.nih.gov/gene/109857", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q8K354", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q8K354*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002347", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002347", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020904", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020904", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036291", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036291", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045313", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045313", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:109857", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:109857", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1309992", "url": "http://www.informatics.jax.org/marker/MGI:1309992", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q8K354", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8K354", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "MAGDYGS", "url": "https://omabrowser.org/oma/group/MAGDYGS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3346557at2759", "url": "http://www.orthodb.org/?query=3346557at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43963", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43963", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43963:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43963:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00106", "url": "http://pfam.xfam.org/family/PF00106", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13561", "url": "http://pfam.xfam.org/family/PF13561", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8K354", "url": "http://purl.obolibrary.org/obo/PR_Q8K354", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-211945", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_766635", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766635", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "19257", "url": "https://www.rhea-db.org/rhea/19257", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46164", "url": "https://www.rhea-db.org/rhea/46164", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A338P797", "url": "https://www.uniprot.org/uniprot/A0A338P797", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A338P797-1", "url": "https://www.uniprot.org/uniprot/A0A338P797-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8K354", "url": "https://www.uniprot.org/uniprot/Q8K354", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8K354-1", "url": "https://www.uniprot.org/uniprot/Q8K354-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSCSRVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVQQLQAEGLSPRFHQLDIDDPQSIRALRDFLRKEYGGLNVLVNNAGIAFRMDDPTPFDIQAEVTLKTNFFATRNVCTELLPIMKPHGRVVNISSLQGLKALENCREDLQEKFRCDTLTEVDLVDLMKKFVEDTKNEVHEREGWPDSAYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMARDQGSRTVEEGAETPVYLALLPPDATEPHGQLVRDKVVQTW", "length": 277, "header": "sp|Q8K354-1|CBR3_MOUSE Isoform 1 of Carbonyl reductase [NADPH] 3 OS=Mus musculus OX=10090 GN=Cbr3 PE=1 SV=1 CANONICAL=Q8K354-1" }, "isoforms": [ { "isoform_ac": "A0A338P797-1", "url": "", "sequence": { "sequence": "MSSCSRVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVQQLQAEGLSPRFHQLDIDDPQSIRALRDFLRKEYGGLNVLVNNAGIAFRRTLFKLETGRSKLSVLETRHERG", "length": 119, "header": "tr|A0A338P797-1|A0A338P797_MOUSE Computationally mapped isoform of Carbonyl reductase 3 OS=Mus musculus OX=10090 GN=Cbr3 PE=1 SV=1 CANONICAL=Q8K354-1" }, "locus": { "chromosome": "16", "start_pos": 93481632, "end_pos": 93480213, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000231302.2", "url": "https://www.ensembl.org/id/ENSMUST00000231302.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000156328.2", "url": "https://www.ensembl.org/id/ENSMUSP00000156328.2" } ] } }, { "isoform_ac": "Q8K354-1", "url": "", "sequence": { "sequence": "MSSCSRVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVQQLQAEGLSPRFHQLDIDDPQSIRALRDFLRKEYGGLNVLVNNAGIAFRMDDPTPFDIQAEVTLKTNFFATRNVCTELLPIMKPHGRVVNISSLQGLKALENCREDLQEKFRCDTLTEVDLVDLMKKFVEDTKNEVHEREGWPDSAYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMARDQGSRTVEEGAETPVYLALLPPDATEPHGQLVRDKVVQTW", "length": 277, "header": "sp|Q8K354-1|CBR3_MOUSE Isoform 1 of Carbonyl reductase [NADPH] 3 OS=Mus musculus OX=10090 GN=Cbr3 PE=1 SV=1 CANONICAL=Q8K354-1" }, "locus": { "chromosome": "16", "start_pos": 93487649, "end_pos": 93480213, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000039620", "url": "https://www.ensembl.org/id/ENSMUST00000039620" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000047712", "url": "https://www.ensembl.org/id/ENSMUSP00000047712" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q8K354", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8K354" }, { "id": "25153642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25153642" }, { "id": "28135057", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28135057" } ] } ], "phosphorylation": [ { "start_pos": 30, "end_pos": 30, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q8K354", "url": "https://www.uniprot.org/uniprot/Q8K354" } ], "site_lbl": "Ser30" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Changes in metabolic chemical reporter structure yield a selective probe of O-GlcNAc modification.", "journal": "Journal of the American Chemical Society", "date": "2014", "authors": "Chuh KN, Zaro BW, Piller F, Piller V, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q8K354", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8K354" } ], "reference": [ { "type": "PubMed", "id": "25153642", "url": "https://glygen.org/publication/PubMed/25153642" } ] }, { "title": "The Small Molecule 2-Azido-2-deoxy-glucose Is a Metabolic Chemical Reporter of O-GlcNAc Modifications in Mammalian Cells, Revealing an Unexpected Promiscuity of O-GlcNAc Transferase.", "journal": "ACS chemical biology", "date": "2017", "authors": "Zaro BW, Batt AR, Chuh KN, Navarro MX, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q8K354", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8K354" } ], "reference": [ { "type": "PubMed", "id": "28135057", "url": "https://glygen.org/publication/PubMed/28135057" } ] } ], "pathway": [ { "id": "mmu:109857", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:109857", "resource": "KEGG Pathway" }, { "id": "R-MMU-211945", "name": "Phase I - Functionalization of compounds", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-211945", "resource": "Reactome", "description": "Phase I - Functionalization of compounds" } ], "orthologs": [ { "uniprot_canonical_ac": "B2GV72-1", "protein_name": "Carbonyl reductase [NADPH] 3", "gene_name": "Cbr3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSSCSRVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVKQLQAEGLSPRFHQLDIDNPQSIRALRDFLRKEYGGLNVLVNNAGIAFRMDDPTPFDVQAEVTLKTNFFATRNVCTELLPIMKPHGRVVNVSSLQGLKALENCSEDLQERFRCDTLTEGDLVDLMKKFVEDTKNEVHEREGWPDSAYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMARDQGSRTVEEGAETPVYLALLPPDATEPHGQLVRDKVVQTW", "length": 277 }, "evidence": [ { "id": "45225793", "url": "http://www.informatics.jax.org/homology/45225793", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q8K354", "url": "https://www.uniprot.org/uniprot/Q8K354" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q8K354", "url": "https://www.uniprot.org/uniprot/Q8K354" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "cognition", "id": "GO:0050890", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050890", "evidence": [ { "database": "UniProtKB", "id": "Q8K354", "url": "https://www.uniprot.org/uniprot/Q8K354" } ], "pmid": "" }, { "name": "phylloquinone catabolic process", "id": "GO:0042376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042376", "evidence": [ { "database": "UniProtKB", "id": "Q8K354", "url": "https://www.uniprot.org/uniprot/Q8K354" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "3-keto sterol reductase activity", "id": "GO:0000253", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000253", "evidence": [ { "database": "UniProtKB", "id": "Q8K354", "url": "https://www.uniprot.org/uniprot/Q8K354" } ], "pmid": "" }, { "name": "NADPH dehydrogenase (quinone) activity", "id": "GO:0008753", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008753", "evidence": [ { "database": "UniProtKB", "id": "Q8K354", "url": "https://www.uniprot.org/uniprot/Q8K354" } ], "pmid": "" }, { "name": "NADPH binding", "id": "GO:0070402", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070402", "evidence": [ { "database": "UniProtKB", "id": "Q8K354", "url": "https://www.uniprot.org/uniprot/Q8K354" } ], "pmid": "" }, { "name": "carbonyl reductase (NADPH) activity", "id": "GO:0004090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004090", "evidence": [ { "database": "UniProtKB", "id": "Q8K354", "url": "https://www.uniprot.org/uniprot/Q8K354" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 137, "end_pos": 139, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "19257", "name": "", "equation": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P47727-1", "Q8VID1-1", "B2GV72-1", "O75828-1", "P16152-1", "Q9BTZ2-1", "A0A1B0GRG8-1", "Q8K354-1", "P48758-1", "P08074-1", "Q99LB2-1" ], "evidence": [ { "id": "19257", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/19257" } ] }, { "id": "46164", "name": "", "equation": "a quinone + H(+) + NADPH = a quinol + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P05982-1", "Q7TS56-1", "B2GV72-1", "P15559-1", "Q8N4T8-1", "O75828-1", "Q64669-1", "Q91VT4-1", "Q8K354-1" ], "evidence": [ { "id": "46164", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46164" } ] }, { "id": "R-MMU-8937419", "name": "CBR3 reduces DOX to DOXOL", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-9659674" ], "output_participant_list": [ "R-ALL-8937418" ], "enzyme_list": [ "Q8K354-1" ], "evidence": [ { "id": "R-MMU-8937419", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8937419" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-8937418", "participant_name": "DOXOL [cytosol]", "crossref": [ { "id": "83970", "database": "COMPOUND", "url": "" }, { "id": "133817", "database": "ChEBI", "url": "" }, { "id": "2677", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0041884", "database": "HMDB Metabolite", "url": "" }, { "id": "000060183860", "database": "ZINC", "url": "" }, { "id": "83970", "database": "COMPOUND", "url": "" }, { "id": "133817", "database": "ChEBI", "url": "" }, { "id": "2677", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0041884", "database": "HMDB Metabolite", "url": "" }, { "id": "000060183860", "database": "ZINC", "url": "" }, { "id": "83970", "database": "COMPOUND", "url": "" }, { "id": "133817", "database": "ChEBI", "url": "" }, { "id": "2677", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0041884", "database": "HMDB Metabolite", "url": "" }, { "id": "000060183860", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-9659674", "participant_name": "doxorubicin [cytosol]", "crossref": [ { "id": "7069", "database": "Guide to Pharmacology", "url": "" }, { "id": "7069", "database": "Guide to Pharmacology", "url": "" }, { "id": "7069", "database": "Guide to Pharmacology", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A1B0GRG8", "gene_name": "Gm5678", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "A0A1B0GRG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1B0GRG8" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "A0A1B0GRG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1B0GRG8" } ] } ] }, { "uniprot_ac": "B2GV72", "gene_name": "Cbr3", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "B2GV72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GV72" } ] }, { "ec_number": "1.6.5.10", "activity": "a quinone + H(+) + NADPH = a quinol + NADP(+).", "evidence": [ { "id": "B2GV72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GV72" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "B2GV72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GV72" } ] } ] }, { "uniprot_ac": "O75828", "gene_name": "CBR3", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "O75828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75828" } ] }, { "ec_number": "1.6.5.10", "activity": "a quinone + H(+) + NADPH = a quinol + NADP(+).", "evidence": [ { "id": "O75828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75828" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "O75828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75828" } ] } ] }, { "uniprot_ac": "P05982", "gene_name": "Nqo1", "activity": [ { "ec_number": "1.6.5.2", "activity": "a quinone + H(+) + NADPH = a quinol + NADP(+).", "evidence": [ { "id": "P05982", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05982" } ] }, { "ec_number": "1.6.5.2", "activity": "", "evidence": [ { "id": "P05982", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05982" } ] } ] }, { "uniprot_ac": "P08074", "gene_name": "Cbr2", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "P08074", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08074" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "P08074", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08074" } ] } ] }, { "uniprot_ac": "P15559", "gene_name": "NQO1", "activity": [ { "ec_number": "1.6.5.2", "activity": "a quinone + H(+) + NADPH = a quinol + NADP(+).", "evidence": [ { "id": "P15559", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15559" } ] }, { "ec_number": "1.6.5.2", "activity": "", "evidence": [ { "id": "P15559", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15559" } ] } ] }, { "uniprot_ac": "P16152", "gene_name": "CBR1", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "P16152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16152" } ] }, { "ec_number": "1.1.1.189", "activity": "NADP(+) + prostaglandin F2alpha = H(+) + NADPH + prostaglandin E2.", "evidence": [ { "id": "P16152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16152" } ] }, { "ec_number": "1.1.1.197", "activity": "NADP(+) + prostaglandin E1 = 15-oxoprostaglandin E1 + H(+) + NADPH.", "evidence": [ { "id": "P16152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16152" } ] }, { "ec_number": "1.1.1.196", "activity": "NADP(+) + prostaglandin D2 = 15-oxoprostaglandin D2 + H(+) + NADPH.", "evidence": [ { "id": "P16152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16152" } ] }, { "ec_number": "1.1.1.71", "activity": "a primary alcohol + NADP(+) = an aldehyde + H(+) + NADPH.", "evidence": [ { "id": "P16152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16152" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "P16152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16152" } ] } ] }, { "uniprot_ac": "P47727", "gene_name": "Cbr1", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "P47727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47727" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "P47727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47727" } ] }, { "ec_number": "1.1.1.189", "activity": "NADP(+) + prostaglandin F2alpha = H(+) + NADPH + prostaglandin E2.", "evidence": [ { "id": "P47727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47727" } ] }, { "ec_number": "1.1.1.197", "activity": "NADP(+) + prostaglandin E1 = 15-oxoprostaglandin E1 + H(+) + NADPH.", "evidence": [ { "id": "P47727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47727" } ] }, { "ec_number": "1.1.1.196", "activity": "NADP(+) + prostaglandin D2 = 15-oxoprostaglandin D2 + H(+) + NADPH.", "evidence": [ { "id": "P47727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47727" } ] }, { "ec_number": "1.1.1.71", "activity": "a primary alcohol + NADP(+) = an aldehyde + H(+) + NADPH.", "evidence": [ { "id": "P47727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47727" } ] } ] }, { "uniprot_ac": "P48758", "gene_name": "Cbr1", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "P48758", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48758" } ] }, { "ec_number": "1.1.1.189", "activity": "NADP(+) + prostaglandin F2alpha = H(+) + NADPH + prostaglandin E2.", "evidence": [ { "id": "P48758", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48758" } ] }, { "ec_number": "1.1.1.197", "activity": "NADP(+) + prostaglandin E1 = 15-oxoprostaglandin E1 + H(+) + NADPH.", "evidence": [ { "id": "P48758", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48758" } ] }, { "ec_number": "1.1.1.196", "activity": "NADP(+) + prostaglandin D2 = 15-oxoprostaglandin D2 + H(+) + NADPH.", "evidence": [ { "id": "P48758", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48758" } ] }, { "ec_number": "1.1.1.71", "activity": "a primary alcohol + NADP(+) = an aldehyde + H(+) + NADPH.", "evidence": [ { "id": "P48758", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48758" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "P48758", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48758" } ] } ] }, { "uniprot_ac": "Q64669", "gene_name": "Nqo1", "activity": [ { "ec_number": "1.6.5.2", "activity": "a quinone + H(+) + NADPH = a quinol + NADP(+).", "evidence": [ { "id": "Q64669", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64669" } ] }, { "ec_number": "1.6.5.2", "activity": "", "evidence": [ { "id": "Q64669", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64669" } ] } ] }, { "uniprot_ac": "Q7TS56", "gene_name": "Cbr4", "activity": [ { "ec_number": "1.1.1.100", "activity": "a (3R)-hydroxyacyl-[ACP] + NADP(+) = a 3-oxoacyl-[ACP] + H(+) + NADPH.", "evidence": [ { "id": "Q7TS56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TS56" } ] }, { "ec_number": "1.6.5.10", "activity": "a quinone + H(+) + NADPH = a quinol + NADP(+).", "evidence": [ { "id": "Q7TS56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TS56" } ] }, { "ec_number": "1.1.1.100", "activity": "", "evidence": [ { "id": "Q7TS56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TS56" } ] } ] }, { "uniprot_ac": "Q8K354", "gene_name": "Cbr3", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "Q8K354", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K354" } ] }, { "ec_number": "1.6.5.10", "activity": "a quinone + H(+) + NADPH = a quinol + NADP(+).", "evidence": [ { "id": "Q8K354", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K354" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "Q8K354", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K354" } ] } ] }, { "uniprot_ac": "Q8N4T8", "gene_name": "CBR4", "activity": [ { "ec_number": "1.1.1.100", "activity": "a (3R)-hydroxyacyl-[ACP] + NADP(+) = a 3-oxoacyl-[ACP] + H(+) + NADPH.", "evidence": [ { "id": "Q8N4T8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N4T8" } ] }, { "ec_number": "1.6.5.10", "activity": "a quinone + H(+) + NADPH = a quinol + NADP(+).", "evidence": [ { "id": "Q8N4T8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N4T8" } ] }, { "ec_number": "1.1.1.100", "activity": "", "evidence": [ { "id": "Q8N4T8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N4T8" } ] } ] }, { "uniprot_ac": "Q8VID1", "gene_name": "Dhrs4", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] }, { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] } ] }, { "uniprot_ac": "Q91VT4", "gene_name": "Cbr4", "activity": [ { "ec_number": "1.1.1.100", "activity": "a (3R)-hydroxyacyl-[ACP] + NADP(+) = a 3-oxoacyl-[ACP] + H(+) + NADPH.", "evidence": [ { "id": "Q91VT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VT4" } ] }, { "ec_number": "1.6.5.10", "activity": "a quinone + H(+) + NADPH = a quinol + NADP(+).", "evidence": [ { "id": "Q91VT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VT4" } ] }, { "ec_number": "1.1.1.100", "activity": "", "evidence": [ { "id": "Q91VT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VT4" } ] } ] }, { "uniprot_ac": "Q99LB2", "gene_name": "Dhrs4", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q99LB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LB2" } ] }, { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "Q99LB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LB2" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "Q99LB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LB2" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q99LB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LB2" } ] } ] }, { "uniprot_ac": "Q9BTZ2", "gene_name": "DHRS4", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "Q9BTZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BTZ2" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "Q9BTZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BTZ2" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }