{ "uniprot_canonical_ac": "Q8K1Z6-1", "uniprot_ac": "Q8K1Z6", "uniprot_id": "GPR18_MOUSE", "mass": { "chemical_mass": 37691.0, "monoisotopic_mass": 37691.0 }, "refseq": { "ac": "NP_877958", "name": "N-arachidonyl glycine receptor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_877958" }, "gene_names": [ { "name": "Gpr18", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8K1Z6", "id": "Q8K1Z6" }, { "name": "Gpr18", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_877958", "id": "NP_877958" } ], "protein_names": [ { "name": "N-arachidonyl glycine receptor", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8K1Z6" }, { "name": "G-protein coupled receptor 18", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8K1Z6" }, { "name": "N-arachidonyl glycine receptor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_877958", "id": "NP_877958" }, { "name": "NAGly receptor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_877958", "id": "NP_877958" }, { "name": "NAGly receptor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8K1Z6" } ], "function": [ { "annotation": "Data (including data from knockout mice) suggest that signal transduction involving GPR18 in corneal epithelium and ciliary epithelium is required for regulation of intraocular pressure.", "evidence": [ { "database": "RefSeq", "id": "NP_877958", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_877958" }, { "database": "PubMed", "id": "23461720", "url": "https://glygen.org/publication/PubMed/23461720" } ] }, { "annotation": "Data indicate that orphan G-protein-coupled receptor GPR18 is required for the normal homeostasis of CD8alphaalpha gammadeltaT and alphabetaT and CD8alphabeta intestinal intraepithelial lymphocyte compartment.", "evidence": [ { "database": "RefSeq", "id": "NP_877958", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_877958" }, { "database": "PubMed", "id": "25348153", "url": "https://glygen.org/publication/PubMed/25348153" } ] }, { "annotation": "GPR18 and its ligand NAGly are modulators of glial and neuronal cells during neuronal damage. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_877958", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_877958" }, { "database": "PubMed", "id": "30871175", "url": "https://glygen.org/publication/PubMed/30871175" } ] }, { "annotation": "GPR18 has a role in the development and reconstitution of thymus-derived intestinal IEL subsets in the steady-state and after bone marrow transplantation Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_877958", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_877958" }, { "database": "PubMed", "id": "26197390", "url": "https://glygen.org/publication/PubMed/26197390" } ] }, { "annotation": "Receptor for endocannabinoid N-arachidonyl glycine (NAGly) (By similarity). However, conflicting results about the role of NAGly as an agonist are reported (PubMed:23104136). Can also be activated by plant-derived and synthetic cannabinoid agonists (By similarity). The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase (By similarity). May contribute to regulation of the immune system (By similarity). Is required for normal homeostasis of CD8+ subsets of intraepithelial lymphocytes (IELs) (CD8alphaalpha and CD8alphabeta IELs) in small intstine by supporting preferential migration of CD8alphaalpha T-cells to intraepithelial compartment over lamina propria compartment, and by mediating their reconstitution into small intestine after bone marrow transplant (PubMed:25348153, PubMed:26197390). Plays a role in hypotensive responses, mediating reduction in intraocular and blood pressure (PubMed:23461720, PubMed:27893106). Mediates NAGly-induced process of reorganization of actin filaments and induction of acrosomal exocytosis (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6#function" }, { "database": "PubMed", "id": "23461720", "url": "https://glygen.org/publication/PubMed/23461720" }, { "database": "PubMed", "id": "25348153", "url": "https://glygen.org/publication/PubMed/25348153" }, { "database": "PubMed", "id": "27893106", "url": "https://glygen.org/publication/PubMed/27893106" }, { "database": "UniProtKB", "id": "Q14330", "url": "https://www.uniprot.org/uniprot/Q14330#function" }, { "database": "PubMed", "id": "23104136", "url": "https://glygen.org/publication/PubMed/23104136" }, { "database": "PubMed", "id": "26197390", "url": "https://glygen.org/publication/PubMed/26197390" } ] }, { "annotation": "The resolvin D2 - GPR18 axis is expressed in human coronary atherosclerosis and transduces atheroprotection in apolipoprotein E deficient mice.", "evidence": [ { "database": "RefSeq", "id": "NP_877958", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_877958" }, { "database": "PubMed", "id": "35525326", "url": "https://glygen.org/publication/PubMed/35525326" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs3405676344", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3405676344" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 190, "end_pos": 190, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->NFR).", "chr_id": "14", "chr_pos": "122149455", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T190", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Gpr18", "url": "https://www.uniprot.org/uniprot/Q8K1Z6", "locus": { "chromosome": "14", "start_pos": 122148665, "end_pos": 122153193, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000050350", "url": "https://www.ensembl.org/id/ENSMUSG00000050350" } ] } } ], "crossref": [ { "id": "ENSMUSG00000050350", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000050350", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd15166", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15166", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "110168", "url": "https://www.ncbi.nlm.nih.gov/gene/110168", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q8K1Z6", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q8K1Z6*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028335", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028335", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:110168", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:110168", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "107859", "url": "http://www.informatics.jax.org/marker/MGI:107859", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "YMINVAV", "url": "https://omabrowser.org/oma/group/YMINVAV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5304717at2759", "url": "http://www.orthodb.org/?query=5304717at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24232", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24232", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24232:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24232:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00001", "url": "http://pfam.xfam.org/family/PF00001", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8K1Z6", "url": "http://purl.obolibrary.org/obo/PR_Q8K1Z6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-373076", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-373076", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418594", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_877958", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_877958", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8K1Z6-1", "url": "https://www.uniprot.org/uniprot/Q8K1Z6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MATLSNHNQLDLSNGSHPEEYKIAALVFYSCIFLIGLFVNVTALWVFSCTTKKRTTVTIYMMNVALLDLVFILSLPFRMFYYAKGEWPFGEYFCHILGALVVFYPSLALWLLAFISADRYMAIVQPKYAKELKNTGKAVLACGGVWVMTLTTTVPLLLLYEDPDKASSPATCLKISDITHLKAVNVLNFTRLIFFFLIPLFIMIGCYVVIIHSLLRGQTSKLKPKVKEKSIRIIMTLLLQVLVCFVPFHICFAVLMLQGQENSYSPWGAFTTFLMNLSTCLDVVLYYIVSKQFQARVISVMLYRNYLRSVRRKSVRSGSLRSLSNMNSEML", "length": 331, "header": "sp|Q8K1Z6-1|GPR18_MOUSE Isoform 1 of N-arachidonyl glycine receptor OS=Mus musculus OX=10090 GN=Gpr18 PE=1 SV=1 CANONICAL=Q8K1Z6-1" }, "isoforms": [ { "isoform_ac": "Q8K1Z6-1", "url": "", "sequence": { "sequence": "MATLSNHNQLDLSNGSHPEEYKIAALVFYSCIFLIGLFVNVTALWVFSCTTKKRTTVTIYMMNVALLDLVFILSLPFRMFYYAKGEWPFGEYFCHILGALVVFYPSLALWLLAFISADRYMAIVQPKYAKELKNTGKAVLACGGVWVMTLTTTVPLLLLYEDPDKASSPATCLKISDITHLKAVNVLNFTRLIFFFLIPLFIMIGCYVVIIHSLLRGQTSKLKPKVKEKSIRIIMTLLLQVLVCFVPFHICFAVLMLQGQENSYSPWGAFTTFLMNLSTCLDVVLYYIVSKQFQARVISVMLYRNYLRSVRRKSVRSGSLRSLSNMNSEML", "length": 331, "header": "sp|Q8K1Z6-1|GPR18_MOUSE Isoform 1 of N-arachidonyl glycine receptor OS=Mus musculus OX=10090 GN=Gpr18 PE=1 SV=1 CANONICAL=Q8K1Z6-1" }, "locus": { "chromosome": "14", "start_pos": 122150023, "end_pos": 122149031, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000055475", "url": "https://www.ensembl.org/id/ENSMUST00000055475" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000061410", "url": "https://www.ensembl.org/id/ENSMUSP00000061410" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 14, "start_aa": "Asn", "end_pos": 14, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn14", "evidence": [ { "id": "Q8K1Z6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1Z6#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 188, "start_aa": "Asn", "end_pos": 188, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn188", "evidence": [ { "id": "Q8K1Z6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1Z6#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 322, "end_pos": 322, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q8K1Z6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8K1Z6" } ], "site_lbl": "Ser322" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6" }, { "database": "iPTMnet", "id": "Q8K1Z6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8K1Z6" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "N-Arachidonyl glycine does not activate G protein-coupled receptor 18 signaling via canonical pathways.", "journal": "Mol. Pharmacol.", "date": "2013", "authors": "Ikeda S.R., Puhl H.L. III, Lu V.B.", "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6" } ], "reference": [ { "type": "PubMed", "id": "23104136", "url": "https://glygen.org/publication/PubMed/23104136" } ] }, { "title": "A GPR18-based signalling system regulates IOP in murine eye.", "journal": "Br. J. Pharmacol.", "date": "2013", "authors": "Caldwell MD, Hu SS, Viswanathan S, Bradshaw H, Kelly ME, Straiker A", "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6" }, { "database": "RefSeq", "id": "NP_877958", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_877958" } ], "reference": [ { "type": "PubMed", "id": "23461720", "url": "https://glygen.org/publication/PubMed/23461720" } ] }, { "title": "GPR18 is required for a normal CD8alphaalpha intestinal intraepithelial lymphocyte compartment.", "journal": "J. Exp. Med.", "date": "2014", "authors": "Wang X, Sumida H, Cyster JG", "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6" }, { "database": "RefSeq", "id": "NP_877958", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_877958" } ], "reference": [ { "type": "PubMed", "id": "25348153", "url": "https://glygen.org/publication/PubMed/25348153" } ] }, { "title": "GPR18 controls reconstitution of mouse small intestine intraepithelial lymphocytes following bone marrow transplantation.", "journal": "PLoS ONE", "date": "2015", "authors": "Becker AM, Callahan DJ, Richner JM, Choi J, DiPersio JF, Diamond MS, Bhattacharya D", "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6" }, { "database": "RefSeq", "id": "NP_877958", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_877958" } ], "reference": [ { "type": "PubMed", "id": "26197390", "url": "https://glygen.org/publication/PubMed/26197390" } ] }, { "title": "Evidence for a GPR18 role in diurnal regulation of intraocular pressure.", "journal": "Invest. Ophthalmol. Vis. Sci.", "date": "2016", "authors": "Miller S, Leishman E, Oehler O, Daily L, Murataeva N, Wager-Miller J, Bradshaw H, Straiker A", "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6" } ], "reference": [ { "type": "PubMed", "id": "27893106", "url": "https://glygen.org/publication/PubMed/27893106" } ] }, { "title": "Protective Effect of N-Arachidonoyl Glycine-GPR18 Signaling after Excitotoxical Lesion in Murine Organotypic Hippocampal Slice Cultures.", "journal": "International journal of molecular sciences", "date": "2019", "authors": "Grabiec U, Hohmann T, Ghadban C, Rothganger C, Wong D, Antonietti A, Groth T, Mackie K, Dehghani F", "evidence": [ { "database": "RefSeq", "id": "NP_877958", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_877958" } ], "reference": [ { "type": "PubMed", "id": "30871175", "url": "https://glygen.org/publication/PubMed/30871175" } ] }, { "title": "The resolvin D2 - GPR18 axis is expressed in human coronary atherosclerosis and transduces atheroprotection in apolipoprotein E deficient mice.", "journal": "Biochemical pharmacology", "date": "2022", "authors": "Bardin M, Pawelzik SC, Lagrange J, Mahdi A, Arnardottir H, Regnault V, Feve B, Lacolley P, Michel JB, Mercier N, Back M", "evidence": [ { "database": "RefSeq", "id": "NP_877958", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_877958" } ], "reference": [ { "type": "PubMed", "id": "35525326", "url": "https://glygen.org/publication/PubMed/35525326" } ] } ], "pathway": [ { "id": "mmu:110168", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:110168", "resource": "KEGG Pathway" }, { "id": "R-MMU-373076", "name": "Class A/1 (Rhodopsin-like receptors)", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-373076", "resource": "Reactome", "description": "Class A/1 (Rhodopsin-like receptors)" }, { "id": "R-MMU-418594", "name": "G alpha (i) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418594", "resource": "Reactome", "description": "G alpha (i) signalling events" } ], "orthologs": [ { "uniprot_canonical_ac": "A1A5S3-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "Gpr18", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAIPSNRDQLALSNGSHPEEYKIAALVFYSCIFLIGLLVNVTALWVFSCTTKKRTTVTIYMMNVALLDLVFILSLPFRMFYYAKGEWPFGDYFCHILGALVVFYPSLALWLLALISADRYMAIVQPKYAKELKNTGKAVLACVGVWIMTLTTTVPLLLLDEDPDKASSPATCLKISDIIHLKAVNVLNFTRLIFFFLIPLFIMIGCYVVIIHSLLRGQTSKLKPKVKEKSIRIIVTLLLQVLACFVPFHICFALLMLQGEENSYSPWGAFTTFLMNLSTCLDVVLYYIVSKQFQARVISVMLYRNYLRSVRRKSVRSGSLRSLSNMNSEML", "length": 331 }, "evidence": [ { "id": "45230021", "url": "http://www.informatics.jax.org/homology/45230021", "database": "MGI" }, { "id": "Q8K1Z6", "url": "https://omabrowser.org/oma/group/Q8K1Z6/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MITLNNQDQPVPFNSSHPDEYKIAALVFYSCIFIIGLFVNITALWVFSCTTKKRTTVTIYMMNVALVDLIFIMTLPFRMFYYAKDEWPFGEYFCQILGALTVFYPSIALWLLAFISADRYMAIVQPKYAKELKNTCKAVLACVGVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIYLKAVNVLNLTRLTFFFLIPLFIMIGCYLVIIHNLLHGRTSKLKPKVKEKSIRIIITLLVQVLVCFMPFHICFAFLMLGTGENSYNPWGAFTTFLMNLSTCLDVILYYIVSKQFQARVISVMLYRNYLRSMRRKSFRSGSLRSLSNINSEML", "length": 331 }, "evidence": [ { "id": "45230021", "url": "http://www.informatics.jax.org/homology/45230021", "database": "MGI" }, { "id": "Q8K1Z6", "url": "https://omabrowser.org/oma/group/Q8K1Z6/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "CD8-positive, alpha-beta intraepithelial T cell differentiation", "id": "GO:0002300", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002300", "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6" } ], "pmid": "" }, { "name": "negative regulation of leukocyte chemotaxis", "id": "GO:0002689", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002689", "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6" } ], "pmid": "" }, { "name": "negative regulation of tumor necrosis factor production", "id": "GO:0032720", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032720", "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6" } ], "pmid": "" }, { "name": "positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway", "id": "GO:0051482", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051482", "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6" } ], "pmid": "" }, { "name": "positive regulation of Rho protein signal transduction", "id": "GO:0035025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035025", "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6" } ], "pmid": "" }, { "name": "CD8-positive, gamma-delta intraepithelial T cell differentiation", "id": "GO:0002305", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002305", "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6" } ], "pmid": "" }, { "name": "cytoplasmic vesicle membrane", "id": "GO:0030659", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030659", "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z6", "url": "https://www.uniprot.org/uniprot/Q8K1Z6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 14, "end_pos": 16, "annotation": "n_glycosylation_sequon" }, { "start_pos": 188, "end_pos": 190, "annotation": "n_glycosylation_sequon" }, { "start_pos": 276, "end_pos": 278, "annotation": "n_glycosylation_sequon" }, { "start_pos": 40, "end_pos": 42, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }