{ "uniprot_canonical_ac": "Q8JZM6-1", "uniprot_ac": "Q8JZM6", "uniprot_id": "TIFAB_MOUSE", "mass": { "chemical_mass": 16636.0, "monoisotopic_mass": 16636.0 }, "refseq": { "ac": "NP_001162086", "name": "TRAF-interacting protein with FHA domain-containing protein B", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001162086" }, "gene_names": [ { "name": "Tifab", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8JZM6", "id": "Q8JZM6" }, { "name": "Tifab", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001162086", "id": "NP_001162086" } ], "protein_names": [ { "name": "TRAF-interacting protein with FHA domain-containing protein B", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8JZM6" }, { "name": "TIFA related protein TIFAB; TIFA like protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001162086", "id": "NP_001162086" }, { "name": "TIFA-like protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8JZM6" }, { "name": "TRAF-interacting protein with FHA domain-containing protein B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001162086", "id": "NP_001162086" } ], "function": [ { "annotation": "Inhibits TIFA-mediated TRAF6 activation possibly by inducing a conformational change in TIFA.", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6#function" }, { "database": "PubMed", "id": "15047173", "url": "https://glygen.org/publication/PubMed/15047173" } ] }, { "annotation": "Retroviral insertional mutagenesis identifies the del(5q) genes, CXXC5, TIFAB and ETF1, as well as the Wnt pathway, as potential targets in del(5q) myeloid neoplasms", "evidence": [ { "database": "RefSeq", "id": "NP_001162086", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001162086" }, { "database": "PubMed", "id": "26944478", "url": "https://glygen.org/publication/PubMed/26944478" } ] }, { "annotation": "Study shows TIFAB is mainly expressed in B cells rather than T cells in the spleen; results suggest TIFAB could act as a negative regulator of TRAF6-induced cellular function such as B cell proliferation and maturation of dendritic cellss & macrophages", "evidence": [ { "database": "RefSeq", "id": "NP_001162086", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001162086" }, { "database": "PubMed", "id": "19470519", "url": "https://glygen.org/publication/PubMed/19470519" } ] }, { "annotation": "TIFAB loss increases TRAF6 protein and the dynamic range of TLR4 signaling", "evidence": [ { "database": "RefSeq", "id": "NP_001162086", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001162086" }, { "database": "PubMed", "id": "26458771", "url": "https://glygen.org/publication/PubMed/26458771" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Tifab", "url": "https://www.uniprot.org/uniprot/Q8JZM6", "locus": { "chromosome": "13", "start_pos": 56321517, "end_pos": 56326698, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000049625", "url": "https://www.ensembl.org/id/ENSMUSG00000049625" } ] } } ], "crossref": [ { "id": "ENSMUSG00000049625", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000049625", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "212937", "url": "https://www.ncbi.nlm.nih.gov/gene/212937", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000253", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000253", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008984", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008984", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033621", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033621", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:212937", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:212937", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2385852", "url": "http://www.informatics.jax.org/marker/MGI:2385852", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "PLIYRPQ", "url": "https://omabrowser.org/oma/group/PLIYRPQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5342708at2759", "url": "http://www.orthodb.org/?query=5342708at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR31266", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31266", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR31266:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31266:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00498", "url": "http://pfam.xfam.org/family/PF00498", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8JZM6", "url": "http://purl.obolibrary.org/obo/PR_Q8JZM6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001162086", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001162086", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8JZM6-1", "url": "https://www.uniprot.org/uniprot/Q8JZM6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MERPLTVLQVSLYHPTQGPVAFAHVPQQLQHDASRLLVGRGQNTHLQLQLPQLSRYHLSLEPYLEKGSSLLAFCLKVLTRKSCVWVNGLPLRYLEQVPLGTINRISFSGIQMLVRKEGGASLETFVCYFHLSPSPLIYRPKAQETDE", "length": 147, "header": "sp|Q8JZM6-1|TIFAB_MOUSE Isoform 1 of TRAF-interacting protein with FHA domain-containing protein B OS=Mus musculus OX=10090 GN=Tifab PE=2 SV=1 CANONICAL=Q8JZM6-1" }, "isoforms": [ { "isoform_ac": "Q8JZM6-1", "url": "", "sequence": { "sequence": "MERPLTVLQVSLYHPTQGPVAFAHVPQQLQHDASRLLVGRGQNTHLQLQLPQLSRYHLSLEPYLEKGSSLLAFCLKVLTRKSCVWVNGLPLRYLEQVPLGTINRISFSGIQMLVRKEGGASLETFVCYFHLSPSPLIYRPKAQETDE", "length": 147, "header": "sp|Q8JZM6-1|TIFAB_MOUSE Isoform 1 of TRAF-interacting protein with FHA domain-containing protein B OS=Mus musculus OX=10090 GN=Tifab PE=2 SV=1 CANONICAL=Q8JZM6-1" }, "locus": { "chromosome": "13", "start_pos": 56324441, "end_pos": 56324001, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000169652", "url": "https://www.ensembl.org/id/ENSMUST00000169652" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000131162", "url": "https://www.ensembl.org/id/ENSMUSP00000131162" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "TIFAB inhibits TIFA, TRAF-interacting protein with a forkhead-associated domain.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2004", "authors": "Matsumura T, Semba K, Azuma S, Ikawa S, Gohda J, Akiyama T, Inoue J", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "reference": [ { "type": "PubMed", "id": "15047173", "url": "https://glygen.org/publication/PubMed/15047173" } ] }, { "title": "TRAF-interacting protein with a forkhead-associated domain B (TIFAB) is a negative regulator of the TRAF6-induced cellular functions.", "journal": "Journal of biochemistry", "date": "2009", "authors": "Matsumura T, Kawamura-Tsuzuku J, Yamamoto T, Semba K, Inoue J", "evidence": [ { "database": "RefSeq", "id": "NP_001162086", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001162086" } ], "reference": [ { "type": "PubMed", "id": "19470519", "url": "https://glygen.org/publication/PubMed/19470519" } ] }, { "title": "Loss of Tifab, a del(5q) MDS gene, alters hematopoiesis through derepression of Toll-like receptor-TRAF6 signaling.", "journal": "The Journal of experimental medicine", "date": "2015", "authors": "Varney ME, Niederkorn M, Konno H, Matsumura T, Gohda J, Yoshida N, Akiyama T, Christie S, Fang J, Miller D, Jerez A, Karsan A, Maciejewski JP, Meetei RA, Inoue J, Starczynowski DT", "evidence": [ { "database": "RefSeq", "id": "NP_001162086", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001162086" } ], "reference": [ { "type": "PubMed", "id": "26458771", "url": "https://glygen.org/publication/PubMed/26458771" } ] }, { "title": "Retroviral insertional mutagenesis identifies the del(5q) genes, CXXC5, TIFAB and ETF1, as well as the Wnt pathway, as potential targets in del(5q) myeloid neoplasms.", "journal": "Haematologica", "date": "2016", "authors": "Stoddart A, Qian Z, Fernald AA, Bergerson RJ, Wang J, Karrison T, Anastasi J, Bartom ET, Sarver AL, McNerney ME, Largaespada DA, Le Beau MM", "evidence": [ { "database": "RefSeq", "id": "NP_001162086", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001162086" } ], "reference": [ { "type": "PubMed", "id": "26944478", "url": "https://glygen.org/publication/PubMed/26944478" } ] } ], "pathway": [ { "id": "mmu:212937", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:212937", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q5BK67-1", "protein_name": "TRAF-interacting protein with FHA domain-containing protein B", "gene_name": "Tifab", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MERPLTVLQVSLYHPTQGPVAFAKVPLQLQHDASRLLVGRGQDTHLQLQLPQLSRHHLCLEPYLEKGSNLLAFCLKVLTRQSCVWVNGLPLRYLEQVPLHSVNRISFSGIQMLIRKEGGASLEAFVCYFHLSPSPLIYRPKAQETDE", "length": 147 }, "evidence": [ { "id": "45244015", "url": "http://www.informatics.jax.org/homology/45244015", "database": "MGI" }, { "id": "Q8JZM6", "url": "https://omabrowser.org/oma/group/Q8JZM6/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6ZNK6-1", "protein_name": "TRAF-interacting protein with FHA domain-containing protein B", "gene_name": "TIFAB", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEKPLTVLRVSLYHPTLGPSAFANVPPRLQHDTSPLLLGRGQDAHLQLQLPRLSRRHLSLEPYLEKGSALLAFCLKALSRKGCVWVNGLTLRYLEQVPLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQPPPGSG", "length": 161 }, "evidence": [ { "id": "45244015", "url": "http://www.informatics.jax.org/homology/45244015", "database": "MGI" }, { "id": "Q8JZM6", "url": "https://omabrowser.org/oma/group/Q8JZM6/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 26, "go_terms": [ { "name": "genitalia development", "id": "GO:0048806", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048806", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "peristalsis", "id": "GO:0030432", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030432", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "auditory behavior", "id": "GO:0031223", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031223", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "regulation of muscle organ development", "id": "GO:0048634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048634", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "mastication", "id": "GO:0071626", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071626", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "craniofacial suture morphogenesis", "id": "GO:0097094", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097094", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "learned vocalization behavior", "id": "GO:0098583", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098583", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "negative regulation of relaxation of muscle", "id": "GO:1901078", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901078", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "negative regulation of saliva secretion", "id": "GO:1905747", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905747", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "hard palate morphogenesis", "id": "GO:1905748", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905748", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "inner ear morphogenesis", "id": "GO:0042472", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042472", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "neuromuscular process controlling balance", "id": "GO:0050885", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050885", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "trigeminal nerve development", "id": "GO:0021559", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021559", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "regulation of gene expression", "id": "GO:0010468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010468", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "inner ear development", "id": "GO:0048839", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048839", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "hematopoietic progenitor cell differentiation", "id": "GO:0002244", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002244", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "I-kappaB kinase/NF-kappaB signaling", "id": "GO:0007249", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007249", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "lipopolysaccharide-mediated signaling pathway", "id": "GO:0031663", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031663", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "vestibulocochlear nerve formation", "id": "GO:0021650", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021650", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "thorax and anterior abdomen determination", "id": "GO:0007356", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007356", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "myeloid cell differentiation", "id": "GO:0030099", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030099", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "cochlea development", "id": "GO:0090102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090102", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "genitalia morphogenesis", "id": "GO:0035112", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035112", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "cochlea morphogenesis", "id": "GO:0090103", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090103", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "regulation of intrinsic apoptotic signaling pathway in response to osmotic stress by p53 class mediator", "id": "GO:1902238", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902238", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" }, { "name": "TRAF-mediated signal transduction", "id": "GO:0038008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038008", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "deubiquitinase activator activity", "id": "GO:0035800", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035800", "evidence": [ { "database": "UniProtKB", "id": "Q8JZM6", "url": "https://www.uniprot.org/uniprot/Q8JZM6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }