{ "uniprot_canonical_ac": "Q8CJC7-1", "uniprot_ac": "Q8CJC7", "uniprot_id": "KLRE1_MOUSE", "mass": { "chemical_mass": 26265.0, "monoisotopic_mass": 26265.0 }, "refseq": { "ac": "NP_705818", "name": "killer cell lectin-like receptor subfamily E member 1 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705818" }, "gene_names": [ { "name": "Klre1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8CJC7", "id": "Q8CJC7" }, { "name": "Klre-1; NKG2I", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705818", "id": "NP_705818" }, { "name": "Klre1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705818", "id": "NP_705818" }, { "name": "NKG2I", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q8CJC7", "id": "Q8CJC7" } ], "protein_names": [ { "name": "Killer cell lectin-like receptor subfamily E member 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8CJC7" }, { "name": "killer cell lectin-like receptor subfamily E member 1 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705818", "id": "NP_705818" }, { "name": "killer cell lectin-like receptor subfamily E member 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705818", "id": "NP_705818" } ], "function": [ { "annotation": "Cloning and functional characterization of a novel natural killer (NK) cell receptor termed KLRE1", "evidence": [ { "database": "RefSeq", "id": "NP_705818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705818" }, { "database": "PubMed", "id": "12782717", "url": "https://glygen.org/publication/PubMed/12782717" } ] }, { "annotation": "Lectin-like receptor for natural killer (NK) cells (PubMed:14707119, PubMed:15069013, PubMed:18713988). Can either inhibit or activate NK cell cytotoxic activity, depending on its binding partner (PubMed:14707119, PubMed:15069013, PubMed:18713988). Heterodimer formation with KLRI1 mediates NK cell inhibition whereas heterodimer formation with KLRI2 mediates NK cell activation (PubMed:18713988). Plays a role in allogeneic recognition by the immune system (PubMed:14707119, PubMed:15069013).", "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7#function" }, { "database": "PubMed", "id": "18713988", "url": "https://glygen.org/publication/PubMed/18713988" }, { "database": "PubMed", "id": "15069013", "url": "https://glygen.org/publication/PubMed/15069013" }, { "database": "PubMed", "id": "14707119", "url": "https://glygen.org/publication/PubMed/14707119" } ] }, { "annotation": "Mediates recognition and rejection of allogeneic target cells in the host immune system", "evidence": [ { "database": "RefSeq", "id": "NP_705818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705818" }, { "database": "PubMed", "id": "15069013", "url": "https://glygen.org/publication/PubMed/15069013" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Klre1", "url": "https://www.uniprot.org/uniprot/Q8CJC7", "locus": { "chromosome": "6", "start_pos": 129562790, "end_pos": 129554868, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000050241", "url": "https://www.ensembl.org/id/ENSMUSG00000050241" } ] } } ], "crossref": [ { "id": "ENSMUSG00000050241", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000050241", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03593", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03593", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "243655", "url": "https://www.ncbi.nlm.nih.gov/gene/243655", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001304", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001304", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016186", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016186", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016187", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016187", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:243655", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:243655", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2662547", "url": "http://www.informatics.jax.org/marker/MGI:2662547", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "HHPCPEN", "url": "https://omabrowser.org/oma/group/HHPCPEN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3031510at2759", "url": "http://www.orthodb.org/?query=3031510at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR22800", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22800", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22800:SF252", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22800:SF252", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00059", "url": "http://pfam.xfam.org/family/PF00059", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8CJC7", "url": "http://purl.obolibrary.org/obo/PR_Q8CJC7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_705818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705818", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0N4SVG0", "url": "https://www.uniprot.org/uniprot/A0A0N4SVG0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0N4SVG0-1", "url": "https://www.uniprot.org/uniprot/A0A0N4SVG0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8CJC7-1", "url": "https://www.uniprot.org/uniprot/Q8CJC7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDEAPVTRSTLNVNSQQKSKAKNKIKNTLNSNELSSIEQRKKYQKHLKKHKNTAEDISGKGNCSPPWRLLSSVLGAMCLLLMAVAMVMTTFTTKSSSERSSSTIQQEGLHHPCPENWVWFRCSCYFFSKEELIWRDSQRACLSLNSSLIRMNKEEMNFFSLKSFFWVGVYYNETRRQWLWEDHSVLPSGLFSKLEANMKNFCASYKSKEAYMEENCANKLTYICKK", "length": 226, "header": "sp|Q8CJC7-1|KLRE1_MOUSE Isoform 1 of Killer cell lectin-like receptor subfamily E member 1 OS=Mus musculus OX=10090 GN=Klre1 PE=1 SV=1 CANONICAL=Q8CJC7-1" }, "isoforms": [ { "isoform_ac": "A0A0N4SVG0-1", "url": "", "sequence": { "sequence": "MDEAPVTRSTLNVNSQQKSKAKNKIKNTLNSNELSSIEQRKKYQKHLKKHKNTAEDISGKGWL", "length": 63, "header": "tr|A0A0N4SVG0-1|KLRE1_MOUSE Computationally mapped isoform of Killer cell lectin-like receptor subfamily E member 1 OS=Mus musculus OX=10090 GN=Klre1 PE=1 SV=1 CANONICAL=Q8CJC7-1" }, "locus": { "chromosome": "6", "start_pos": 129558835, "end_pos": 129556900, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000203322.2", "url": "https://www.ensembl.org/id/ENSMUST00000203322.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000145085.2", "url": "https://www.ensembl.org/id/ENSMUSP00000145085.2" } ] } }, { "isoform_ac": "Q8CJC7-1", "url": "", "sequence": { "sequence": "MDEAPVTRSTLNVNSQQKSKAKNKIKNTLNSNELSSIEQRKKYQKHLKKHKNTAEDISGKGNCSPPWRLLSSVLGAMCLLLMAVAMVMTTFTTKSSSERSSSTIQQEGLHHPCPENWVWFRCSCYFFSKEELIWRDSQRACLSLNSSLIRMNKEEMNFFSLKSFFWVGVYYNETRRQWLWEDHSVLPSGLFSKLEANMKNFCASYKSKEAYMEENCANKLTYICKK", "length": 226, "header": "sp|Q8CJC7-1|KLRE1_MOUSE Isoform 1 of Killer cell lectin-like receptor subfamily E member 1 OS=Mus musculus OX=10090 GN=Klre1 PE=1 SV=1 CANONICAL=Q8CJC7-1" }, "locus": { "chromosome": "6", "start_pos": 129562654, "end_pos": 129556900, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000053708", "url": "https://www.ensembl.org/id/ENSMUST00000053708" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000055779", "url": "https://www.ensembl.org/id/ENSMUSP00000055779" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 145, "start_aa": "Asn", "end_pos": 145, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn145", "evidence": [ { "id": "Q8CJC7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CJC7#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Identification of a new murine lectin-like gene in close proximity to CD94.", "journal": "Immunogenetics", "date": "2003", "authors": "Mager D.L., Wilhelm B.T.", "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7" } ], "reference": [ { "type": "PubMed", "id": "12715246", "url": "https://glygen.org/publication/PubMed/12715246" } ] }, { "title": "The lectin-like receptor KLRE1 inhibits natural killer cell cytotoxicity.", "journal": "J. Exp. Med.", "date": "2003", "authors": "Westgaard IH, Dissen E, Torgersen KM, Lazetic S, Lanier LL, Phillips JH, Fossum S", "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7" }, { "database": "RefSeq", "id": "NP_705818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705818" } ], "reference": [ { "type": "PubMed", "id": "12782717", "url": "https://glygen.org/publication/PubMed/12782717" } ] }, { "title": "Bone marrow allograft rejection mediated by a novel murine NK receptor, NKG2I.", "journal": "J. Exp. Med.", "date": "2004", "authors": "Koike J, Wakao H, Ishizuka Y, Sato TA, Hamaoki M, Seino K, Koseki H, Nakayama T, Taniguchi M", "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7" } ], "reference": [ { "type": "PubMed", "id": "14707119", "url": "https://glygen.org/publication/PubMed/14707119" } ] }, { "title": "Role of a NK receptor, KLRE-1, in bone marrow allograft rejection: analysis with KLRE-1-deficient mice.", "journal": "Blood", "date": "2004", "authors": "Shimizu E, Koike J, Wakao H, Seino K, Koseki H, Kakiuchi T, Nakayama T, Taniguchi M", "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7" }, { "database": "RefSeq", "id": "NP_705818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705818" } ], "reference": [ { "type": "PubMed", "id": "15069013", "url": "https://glygen.org/publication/PubMed/15069013" } ] }, { "title": "KLRE/I1 and KLRE/I2: a novel pair of heterodimeric receptors that inversely regulate NK cell cytotoxicity.", "journal": "J. Immunol.", "date": "2008", "authors": "Saether PC, Westgaard IH, Hoelsbrekken SE, Benjamin J, Lanier LL, Fossum S, Dissen E", "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7" } ], "reference": [ { "type": "PubMed", "id": "18713988", "url": "https://glygen.org/publication/PubMed/18713988" } ] } ], "pathway": [ { "id": "mmu:243655", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:243655", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q80ZC8-1", "protein_name": "Killer cell lectin-like receptor subfamily E member 1", "gene_name": "Klre1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MNQTLIICSTLNVNSQQKSKAKNSMKNTFHSNELSSIEQRQKYQKHLKKDKKTAEDITGVGNCSPPWRLISSVLFVVCLLLMAVAMVMTIFTTRLSSERSSSNIHQEGLHHPCPENWVWFRCSCYYFSKEKLVWRESQRACLSFNSSLIRMNKEEMDFFSLKSFFWVGVYYDETSKQWLWDDHSVLPSGMFSGLESSPKNFCASYKSKEAYLAENCSTKLMYICKK", "length": 226 }, "evidence": [ { "id": "45244740", "url": "http://www.informatics.jax.org/homology/45244740", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "transmembrane signaling receptor activity", "id": "GO:0004888", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004888", "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7" } ], "pmid": "" }, { "name": "carbohydrate binding", "id": "GO:0030246", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030246", "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7" } ], "pmid": "" }, { "name": "protein phosphatase binding", "id": "GO:0019903", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019903", "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "positive regulation of type II interferon production", "id": "GO:0032729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032729", "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7" } ], "pmid": "" }, { "name": "positive regulation of natural killer cell mediated cytotoxicity", "id": "GO:0045954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045954", "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7" } ], "pmid": "" }, { "name": "natural killer cell activation", "id": "GO:0030101", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030101", "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7" } ], "pmid": "" }, { "name": "negative regulation of natural killer cell mediated cytotoxicity directed against tumor cell target", "id": "GO:0002859", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002859", "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7" } ], "pmid": "" }, { "name": "stimulatory C-type lectin receptor signaling pathway", "id": "GO:0002223", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002223", "evidence": [ { "database": "UniProtKB", "id": "Q8CJC7", "url": "https://www.uniprot.org/uniprot/Q8CJC7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 145, "end_pos": 147, "annotation": "n_glycosylation_sequon" }, { "start_pos": 172, "end_pos": 174, "annotation": "n_glycosylation_sequon" }, { "start_pos": 62, "end_pos": 64, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }