{ "uniprot_canonical_ac": "Q8CHX7-1", "uniprot_ac": "Q8CHX7", "uniprot_id": "RFTN2_MOUSE", "mass": { "chemical_mass": 54972.0, "monoisotopic_mass": 54972.0 }, "refseq": { "ac": "NP_082989", "name": "raftlin-2 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082989" }, "gene_names": [ { "name": "Rftn2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8CHX7", "id": "Q8CHX7" }, { "name": "2700010E02Rik; 3222401M22Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082989", "id": "NP_082989" }, { "name": "Rftn2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082989", "id": "NP_082989" } ], "protein_names": [ { "name": "Raftlin-2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8CHX7" }, { "name": "Raft-linking protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8CHX7" }, { "name": "raftlin-2 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082989", "id": "NP_082989" }, { "name": "raftlin-2; raft-linking protein 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082989", "id": "NP_082989" } ], "function": [ { "annotation": "Upon bacterial lipopolysaccharide stimulation, mediates clathrin-dependent internalization of TLR4 in dendritic cells, resulting in activation of TICAM1-mediated signaling and subsequent IFNB1 production (PubMed:27022195). May regulate B-cell antigen receptor-mediated signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q8CHX7", "url": "https://www.uniprot.org/uniprot/Q8CHX7#function" }, { "database": "PubMed", "id": "27022195", "url": "https://glygen.org/publication/PubMed/27022195" }, { "database": "PubMed", "id": "19414744", "url": "https://glygen.org/publication/PubMed/19414744" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8CHX7", "url": "https://www.uniprot.org/uniprot/Q8CHX7" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Rftn2", "url": "https://www.uniprot.org/uniprot/Q8CHX7", "locus": { "chromosome": "1", "start_pos": 55209318, "end_pos": 55265941, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000025978", "url": "https://www.ensembl.org/id/ENSMUSG00000025978" } ] } } ], "crossref": [ { "id": "ENSMUSG00000025978", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000025978", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "74013", "url": "https://www.ncbi.nlm.nih.gov/gene/74013", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR028169", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028169", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:74013", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:74013", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1921263", "url": "http://www.informatics.jax.org/marker/MGI:1921263", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "SWTYQEG", "url": "https://omabrowser.org/oma/group/SWTYQEG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5356003at2759", "url": "http://www.orthodb.org/?query=5356003at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR17601", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR17601", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR17601:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR17601:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15250", "url": "http://pfam.xfam.org/family/PF15250", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8CHX7", "url": "http://purl.obolibrary.org/obo/PR_Q8CHX7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_082989", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082989", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "M0QWQ1", "url": "https://www.uniprot.org/uniprot/M0QWQ1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0QWQ1-1", "url": "https://www.uniprot.org/uniprot/M0QWQ1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8CHX7", "url": "https://www.uniprot.org/uniprot/Q8CHX7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8CHX7-1", "url": "https://www.uniprot.org/uniprot/Q8CHX7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8CHX7-2", "url": "https://www.uniprot.org/uniprot/Q8CHX7-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGCGLRKLEDPDESSPGKIFSTLKRPQVETKTEFAYEYALLDFTLQASTNPDVIKINSVLDIVAKVEDYYLKGYVVGAIHPVIQPVGQRKHLPASHLYRAVLSRLKLSPKHSAAGGQRRARLVMEECPLTCEAQANDAAKELMDKINAAAKRGMKFVGLVSQCYLPSMHCNGASHDGVAESGLHVRQDSQDNCKGWNEGALGGHLSESGVEEEPQHESGQHQTERNSSPSYANPKRGEAPDGKLYMVFNAFEEDAASWAYQEGVLSMKVTRKGAVISALDANWLELTTFYYKQGFSLIDSFVCWETPKGDQLPKSLEGFFIYEEEGSGVPGSNRRGNDAIVVEQWTVIEGCEIKTDYGPLLHTLAEFGWLLTSVLPTPILRHDSEGNLATKQVVFLQRPVTWNSAAQTPERKGSRLLKGEDRNKVSSRSLGLDTNASQAAGGRAPLEEGSLSPSRECWTKEERPAQSDSFSGFSSSDSVLRELDDGQFDQEEGVTQVTCM", "length": 500, "header": "sp|Q8CHX7-1|RFTN2_MOUSE Isoform 1 of Raftlin-2 OS=Mus musculus OX=10090 GN=Rftn2 PE=1 SV=3 CANONICAL=Q8CHX7-1" }, "isoforms": [ { "isoform_ac": "M0QWQ1-1", "url": "", "sequence": { "sequence": "MGCGLRKLEDPDESSPGKIFSTLKRPQVETKTEFAYEYALLDFTLQD", "length": 47, "header": "tr|M0QWQ1-1|M0QWQ1_MOUSE Computationally mapped isoform of Raftlin family member 2 OS=Mus musculus OX=10090 GN=Rftn2 PE=1 SV=1 CANONICAL=Q8CHX7-1" }, "locus": { "chromosome": "1", "start_pos": 55265418, "end_pos": 55245773, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000132055.8", "url": "https://www.ensembl.org/id/ENSMUST00000132055.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000137942.2", "url": "https://www.ensembl.org/id/ENSMUSP00000137942.2" } ] } }, { "isoform_ac": "Q8CHX7-1", "url": "", "sequence": { "sequence": "MGCGLRKLEDPDESSPGKIFSTLKRPQVETKTEFAYEYALLDFTLQASTNPDVIKINSVLDIVAKVEDYYLKGYVVGAIHPVIQPVGQRKHLPASHLYRAVLSRLKLSPKHSAAGGQRRARLVMEECPLTCEAQANDAAKELMDKINAAAKRGMKFVGLVSQCYLPSMHCNGASHDGVAESGLHVRQDSQDNCKGWNEGALGGHLSESGVEEEPQHESGQHQTERNSSPSYANPKRGEAPDGKLYMVFNAFEEDAASWAYQEGVLSMKVTRKGAVISALDANWLELTTFYYKQGFSLIDSFVCWETPKGDQLPKSLEGFFIYEEEGSGVPGSNRRGNDAIVVEQWTVIEGCEIKTDYGPLLHTLAEFGWLLTSVLPTPILRHDSEGNLATKQVVFLQRPVTWNSAAQTPERKGSRLLKGEDRNKVSSRSLGLDTNASQAAGGRAPLEEGSLSPSRECWTKEERPAQSDSFSGFSSSDSVLRELDDGQFDQEEGVTQVTCM", "length": 500, "header": "sp|Q8CHX7-1|RFTN2_MOUSE Isoform 1 of Raftlin-2 OS=Mus musculus OX=10090 GN=Rftn2 PE=1 SV=3 CANONICAL=Q8CHX7-1" }, "locus": { "chromosome": "1", "start_pos": 55265418, "end_pos": 55210972, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000027121", "url": "https://www.ensembl.org/id/ENSMUST00000027121" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000027121", "url": "https://www.ensembl.org/id/ENSMUSP00000027121" } ] } }, { "isoform_ac": "Q8CHX7-2", "url": "", "sequence": { "sequence": "MGCGLRKLEDPDESSPGKIFSTLKRPQVETKTEFAYEYALLDFTLQASTNPDVIKINSVLDIVAKVEDYYLKGYVVGAIHPVIQPVGQRKHLPASHLYRAVLSRLKLSPKHSAAGGQRRARLVMEECPLTCEAQANDAAKELMDKINAAAKRGMKFVGLVSQCYLPSMHCNGASHDGVAESGLHVRQDSQDNCKGWNEGALGGHLSESGVEEEPQHESGQHQTERNSSPSYANPKRGEAPDGKLYMVFNAFEEDAASWAYQEGVLSMKVTRKGAVISALDANWLELTTFYYKQGFSLIDSFVCWETPKVAKLEAFQLSVSDKLPKGKQKYSFQSLSGIPASGLA", "length": 344, "header": "sp|Q8CHX7-2|RFTN2_MOUSE Isoform 2 of Raftlin-2 OS=Mus musculus OX=10090 GN=Rftn2 PE=1 SV=3 CANONICAL=Q8CHX7-1" }, "locus": { "chromosome": "1", "start_pos": 55265418, "end_pos": 55241267, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000114428", "url": "https://www.ensembl.org/id/ENSMUST00000114428" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000110071", "url": "https://www.ensembl.org/id/ENSMUSP00000110071" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 404, "end_pos": 404, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q8CHX7", "url": "https://www.uniprot.org/uniprot/Q8CHX7" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q8CHX7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8CHX7" } ], "site_lbl": "Ser404" }, { "start_pos": 408, "end_pos": 408, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q8CHX7", "url": "https://www.uniprot.org/uniprot/Q8CHX7" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q8CHX7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8CHX7" } ], "site_lbl": "Thr408" }, { "start_pos": 429, "end_pos": 429, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q8CHX7", "url": "https://www.uniprot.org/uniprot/Q8CHX7" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q8CHX7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8CHX7" } ], "site_lbl": "Ser429" } ], "glycation": [], "keywords": [], "publication": [ { "title": "A major lipid raft protein raftlin modulates T cell receptor signaling and enhances th17-mediated autoimmune responses.", "journal": "J. Immunol.", "date": "2009", "authors": "Kobayashi T., Nakagawa R., Takaesu G., Hanada T., Yoshimura A., Matsumura Y., Aki D., Saeki K., Nakaya M., Fukuyama S., Ayada T.", "evidence": [ { "database": "UniProtKB", "id": "Q8CHX7", "url": "https://www.uniprot.org/uniprot/Q8CHX7" } ], "reference": [ { "type": "PubMed", "id": "19414744", "url": "https://glygen.org/publication/PubMed/19414744" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q8CHX7", "url": "https://www.uniprot.org/uniprot/Q8CHX7" }, { "database": "iPTMnet", "id": "Q8CHX7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8CHX7" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "Raftlin controls lipopolysaccharide-induced TLR4 internalization and TICAM-1 signaling in a cell type-specific manner.", "journal": "J. Immunol.", "date": "2016", "authors": "Tatematsu M, Yoshida R, Morioka Y, Ishii N, Funami K, Watanabe A, Saeki K, Seya T, Matsumoto M", "evidence": [ { "database": "UniProtKB", "id": "Q8CHX7", "url": "https://www.uniprot.org/uniprot/Q8CHX7" } ], "reference": [ { "type": "PubMed", "id": "27022195", "url": "https://glygen.org/publication/PubMed/27022195" } ] } ], "pathway": [ { "id": "mmu:74013", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:74013", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I5XV77-1", "protein_name": "Raftlin family member 2", "gene_name": "Rftn2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGCGLRKLEDPDESSPGKIFSTLKRPQVETKTEFAYEYALLDFTLQASTNPEVIKINSVLDIVAKVEDYYLKGYVVGAIHPVIQPVGQRKHLPASHLYRAVLSRVKLSSKHSAAGGQRRARLVIEECPLTCETQGNDSAKELIDKVNAAAKRGMRFVGFVPQHCSPSKHCNGASQDGVAESELHKRQGSQDNCKSLNDGTLWESGVEEEPQPESGQHQTEGNSSLSYSNPKRGEAPDNKVYMVFNAFEEDSACWTYQEGILSMKVTRKGAVISTLDANWLELTTFYYKQGLSLVDSFVCWETPKGDQLPKSLEGFFIYEEEGSGVPGSNRRGNDAIVVEQWTVIEGCEIKTDYGPLLHTLAEFGWLLTSVLPTPILRHDSEGNLATKQVVFLQRPVTWNSAAQTPERKGGRLLRGEDRNKVGSRSIGLDTSECQPAGGRAPLEEGPLSPSRECWTKEERPTQSDSFSGFSGSDSVLRELDDGQFDQEEGVTQVTCM", "length": 496 }, "evidence": [ { "id": "45232546", "url": "http://www.informatics.jax.org/homology/45232546", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q52LD8-1", "protein_name": "Raftlin-2", "gene_name": "RFTN2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTEFAYEYVLLDFTLQASSNPEVIKINSILDIVTKVENYYLKGYIVGAIHPVIQPVGQRKHLPASYLYRVVLLRLKLSPKNSAAPSGQRRPRLVIEECPLTSEAQTNDAAKELIEKINVAAKRGMKFVGFISQHYSPSKFCNGTNHDGDIESMLHVRHGSDENCRSWNEGTLSGQSSESGIEEELHHESGQYQMEQNGSPTSSKSRKGEASDNKLYTVFNAFDDDSTSWAYQEGILSMKVTRKGSVISTLDADWLELTTFYYKQGLSLIDSFVFWETSKGEHLPKSLEGFFIYEEEGSGVPGSSRKGNDAIVVEQWTVIEGCEIKTDYGPLLHTLAEFGWLLTSVLPTPVLRHDSEGNLATKQIVFLQRPVMWNSAAQTPDKKASRHIKGEDKNKATSRSIGLDTTSSQPAESRHLPEECRLSPSRECWTKEGRLAQHNSFSGFSSSDNVLRELDDGQFDQEDGVTQVTCM", "length": 501 }, "evidence": [ { "id": "45232546", "url": "http://www.informatics.jax.org/homology/45232546", "database": "MGI" }, { "id": "Q8CHX7", "url": "https://omabrowser.org/oma/group/Q8CHX7/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q8CHX7", "url": "https://www.uniprot.org/uniprot/Q8CHX7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "response to exogenous dsRNA", "id": "GO:0043330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043330", "evidence": [ { "database": "UniProtKB", "id": "Q8CHX7", "url": "https://www.uniprot.org/uniprot/Q8CHX7" } ], "pmid": "" }, { "name": "dsRNA transport", "id": "GO:0033227", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033227", "evidence": [ { "database": "UniProtKB", "id": "Q8CHX7", "url": "https://www.uniprot.org/uniprot/Q8CHX7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 226, "end_pos": 228, "annotation": "n_glycosylation_sequon" }, { "start_pos": 435, "end_pos": 437, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }