{
    "uniprot_canonical_ac": "Q8CE23-1",
    "uniprot_ac": "Q8CE23",
    "uniprot_id": "OX26_MOUSE",
    "mass": {
        "chemical_mass": 13485.0,
        "monoisotopic_mass": 13485.0
    },
    "refseq": {
        "ac": "NP_906269",
        "name": "orexigenic neuropeptide QRFP preproprotein",
        "summary": "This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. The encoded products are members of the RFamide family of neuropeptides, characterized by their common protein C-terminus consisting of an arginine (R) and an amidated phenylalanine (F). These products include the neuropeptides QRFP-26 (26RFa) and the N-terminally extended form, QRFP-43 (43RFa). Both of these neuropeptides bind to the pyroglutamylated RFamide peptide receptor (QRFPR) and may regulate blood pressure, reproduction and food intake. [provided by RefSeq, Sep 2015].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_906269"
    },
    "gene_names": [
        {
            "name": "Qrfp",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q8CE23",
            "id": "Q8CE23"
        },
        {
            "name": "P518",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_906269",
            "id": "NP_906269"
        },
        {
            "name": "Qrfp",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_906269",
            "id": "NP_906269"
        }
    ],
    "protein_names": [
        {
            "name": "Orexigenic neuropeptide QRFP",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q8CE23"
        },
        {
            "name": "Neuropeptide RF-amide",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8CE23"
        },
        {
            "name": "P518",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8CE23"
        },
        {
            "name": "Pyroglutamylated arginine-phenylalanine-amide peptide",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8CE23"
        },
        {
            "name": "orexigenic neuropeptide QRFP preproprotein",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_906269",
            "id": "NP_906269"
        },
        {
            "name": "orexigenic neuropeptide QRFP; P518 precursor protein (P518)",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_906269",
            "id": "NP_906269"
        }
    ],
    "function": [
        {
            "annotation": "Characterization and tissue distribution of SP9155 (GPR103) ligand.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_906269",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_906269"
                },
                {
                    "database": "PubMed",
                    "id": "12714592",
                    "url": "https://glygen.org/publication/PubMed/12714592"
                }
            ]
        },
        {
            "annotation": "Glucose homeostasis is impaired in mice deficient in the neuropeptide 26RFa (QRFP).",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_906269",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_906269"
                },
                {
                    "database": "PubMed",
                    "id": "32114486",
                    "url": "https://glygen.org/publication/PubMed/32114486"
                }
            ]
        },
        {
            "annotation": "P518/26RFa is a neuropeptide that stimulates food intake in mice.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_906269",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_906269"
                },
                {
                    "database": "PubMed",
                    "id": "15891009",
                    "url": "https://glygen.org/publication/PubMed/15891009"
                }
            ]
        },
        {
            "annotation": "Qrfp polymorphisms is associated with osteopenia",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_906269",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_906269"
                },
                {
                    "database": "PubMed",
                    "id": "17869477",
                    "url": "https://glygen.org/publication/PubMed/17869477"
                }
            ]
        },
        {
            "annotation": "Role of pyroglutamylated RFamide peptide43 in germ cell dynamics in mice testes in relation to energy metabolism.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_906269",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_906269"
                },
                {
                    "database": "PubMed",
                    "id": "32504656",
                    "url": "https://glygen.org/publication/PubMed/32504656"
                }
            ]
        },
        {
            "annotation": "Stimulates feeding and grooming behavior, metabolic rate and locomotor activity and increases blood pressure. May have orexigenic activity. May promote aldosterone secretion by the adrenal gland.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8CE23",
                    "url": "https://www.uniprot.org/uniprot/Q8CE23#function"
                },
                {
                    "database": "PubMed",
                    "id": "16648250",
                    "url": "https://glygen.org/publication/PubMed/16648250"
                }
            ]
        },
        {
            "annotation": "This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. The encoded products are members of the RFamide family of neuropeptides, characterized by their common protein C-terminus consisting of an arginine (R) and an amidated phenylalanine (F). These products include the neuropeptides QRFP-26 (26RFa) and the N-terminally extended form, QRFP-43 (43RFa). Both of these neuropeptides bind to the pyroglutamylated RFamide peptide receptor (QRFPR) and may regulate blood pressure, reproduction and food intake. [provided by RefSeq, Sep 2015].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_906269",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_906269"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8CE23",
                    "url": "https://www.uniprot.org/uniprot/Q8CE23"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Qrfp",
            "url": "https://www.uniprot.org/uniprot/Q8CE23",
            "locus": {
                "chromosome": "2",
                "start_pos": 31696178,
                "end_pos": 31700592,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000043102",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000043102"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000043102",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000043102",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "227717",
            "url": "https://www.ncbi.nlm.nih.gov/gene/227717",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR024565",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR024565",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:227717",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:227717",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "3630329",
            "url": "http://www.informatics.jax.org/marker/MGI:3630329",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "MRAPYSL",
            "url": "https://omabrowser.org/oma/group/MRAPYSL/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5315787at2759",
            "url": "http://www.orthodb.org/?query=5315787at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR36476",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR36476",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR36476:SF1",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR36476:SF1",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF11109",
            "url": "http://pfam.xfam.org/family/PF11109",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q8CE23",
            "url": "http://purl.obolibrary.org/obo/PR_Q8CE23",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-MMU-389397",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-389397",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-MMU-416476",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-416476",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_906269",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_906269",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8CE23",
            "url": "https://www.uniprot.org/uniprot/Q8CE23",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8CE23-1",
            "url": "https://www.uniprot.org/uniprot/Q8CE23-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MRGFRPLLSLLLPLSACFPLLDRRGPTDIGDIGARMNWAQLAEGHPPNSVQNPQPQALLVVAREQQASHREHTGFRLGRQDGSSEAAGFLPADSEKASGPLGTLAEELSSYSRRKGGFSFRFGR",
        "length": 124,
        "header": "sp|Q8CE23-1|OX26_MOUSE Isoform 1 of Orexigenic neuropeptide QRFP  OS=Mus musculus OX=10090 GN=Qrfp PE=2 SV=1 CANONICAL=Q8CE23-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q8CE23-1",
            "url": "",
            "sequence": {
                "sequence": "MRGFRPLLSLLLPLSACFPLLDRRGPTDIGDIGARMNWAQLAEGHPPNSVQNPQPQALLVVAREQQASHREHTGFRLGRQDGSSEAAGFLPADSEKASGPLGTLAEELSSYSRRKGGFSFRFGR",
                "length": 124,
                "header": "sp|Q8CE23-1|OX26_MOUSE Isoform 1 of Orexigenic neuropeptide QRFP  OS=Mus musculus OX=10090 GN=Qrfp PE=2 SV=1 CANONICAL=Q8CE23-1"
            },
            "locus": {
                "chromosome": "2",
                "start_pos": 31698930,
                "end_pos": 31698559,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000057407",
                        "url": "https://www.ensembl.org/id/ENSMUST00000057407"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000055746",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000055746"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Identification and characterization of a novel RF-amide peptide ligand for orphan G-protein-coupled receptor SP9155.",
            "journal": "J. Biol. Chem.",
            "date": "2003",
            "authors": "Jiang Y, Luo L, Gustafson EL, Yadav D, Laverty M, Murgolo N, Vassileva G, Zeng M, Laz TM, Behan J, Qiu P, Wang L, Wang S, Bayne M, Greene J, Monsma F Jr, Zhang FL",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8CE23",
                    "url": "https://www.uniprot.org/uniprot/Q8CE23"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_906269",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_906269"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12714592",
                    "url": "https://glygen.org/publication/PubMed/12714592"
                }
            ]
        },
        {
            "title": "A new peptidic ligand and its receptor regulating adrenal function in rats.",
            "journal": "J. Biol. Chem.",
            "date": "2003",
            "authors": "Fukusumi S, Yoshida H, Fujii R, Maruyama M, Komatsu H, Habata Y, Shintani Y, Hinuma S, Fujino M",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8CE23",
                    "url": "https://www.uniprot.org/uniprot/Q8CE23"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12960173",
                    "url": "https://glygen.org/publication/PubMed/12960173"
                }
            ]
        },
        {
            "title": "Identification of 26RFa from frog brain: a novel hypothalamic neuropeptide with orexigenic activity in mammals.",
            "journal": "Annals of the New York Academy of Sciences",
            "date": "2005",
            "authors": "Chartrel N, Bruzzone F, Dujardin C, Leprince J, Tollemer H, Anouar Y, Vallarino M, Costentin J, Vaudry H",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_906269",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_906269"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15891009",
                    "url": "https://glygen.org/publication/PubMed/15891009"
                }
            ]
        },
        {
            "title": "A neuropeptide ligand of the G protein-coupled receptor GPR103 regulates feeding, behavioral arousal, and blood pressure in mice.",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "2006",
            "authors": "Takayasu S, Sakurai T, Iwasaki S, Teranishi H, Yamanaka A, Williams SC, Iguchi H, Kawasawa YI, Ikeda Y, Sakakibara I, Ohno K, Ioka RX, Murakami S, Dohmae N, Xie J, Suda T, Motoike T, Ohuchi T, Yanagisawa M, Sakai J",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8CE23",
                    "url": "https://www.uniprot.org/uniprot/Q8CE23"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16648250",
                    "url": "https://glygen.org/publication/PubMed/16648250"
                }
            ]
        },
        {
            "title": "P518/Qrfp sequence polymorphisms in SAMP6 osteopenic mouse.",
            "journal": "Genomics",
            "date": "2007",
            "authors": "Zhang Q, Qiu P, Arreaza MG, Simon JS, Golovko A, Laverty M, Vassileva G, Gustafson EL, Rojas-Triana A, Bober LA, Hedrick JA, Monsma FJ Jr, Greene JR, Bayne ML, Murgolo NJ",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_906269",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_906269"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17869477",
                    "url": "https://glygen.org/publication/PubMed/17869477"
                }
            ]
        },
        {
            "title": "Glucose homeostasis is impaired in mice deficient in the neuropeptide 26RFa (QRFP).",
            "journal": "BMJ open diabetes research & care",
            "date": "2020",
            "authors": "El-Mehdi M, Takhlidjt S, Khiar F, Prevost G, do Rego JL, do Rego JC, Benani A, Nedelec E, Godefroy D, Arabo A, Lefranc B, Leprince J, Anouar Y, Chartrel N, Picot M",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_906269",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_906269"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "32114486",
                    "url": "https://glygen.org/publication/PubMed/32114486"
                }
            ]
        },
        {
            "title": "Role of pyroglutamylated RFamide peptide43 in germ cell dynamics in mice testes in relation to energy metabolism.",
            "journal": "Biochimie",
            "date": "2020",
            "authors": "Patel SK, Singh SK",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_906269",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_906269"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "32504656",
                    "url": "https://glygen.org/publication/PubMed/32504656"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:227717",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:227717",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-MMU-389397",
            "name": "Orexin and neuropeptides FF and QRFP bind to their respective receptors",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-389397",
            "resource": "Reactome",
            "description": "Orexin and neuropeptides FF and QRFP bind to their respective receptors"
        },
        {
            "id": "R-MMU-416476",
            "name": "G alpha (q) signalling events",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-416476",
            "resource": "Reactome",
            "description": "G alpha (q) signalling events"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "P83859-1",
            "protein_name": "Orexigenic neuropeptide QRFP",
            "gene_name": "QRFP",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MVRPYPLIYFLFLPLGACFPLLDRREPTDAMGGLGAGERWADLAMGPRPHSVWGSSRWLRASQPQALLVIARGLQTSGREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFRFGRR",
                "length": 136
            },
            "evidence": [
                {
                    "id": "45243410",
                    "url": "http://www.informatics.jax.org/homology/45243410",
                    "database": "MGI"
                },
                {
                    "id": "Q8CE23",
                    "url": "https://omabrowser.org/oma/group/Q8CE23/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "P83860-1",
            "protein_name": "Orexigenic neuropeptide QRFP",
            "gene_name": "Qrfp",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MRCLCSWLCLLLPLSACFPLLDRRGPTDIGDIGARMSWVQLTEGHTPRSVQSPRPQALLVVAKEQQASRREHTGFRLGRQDSGSEATGFLPTDSEKASGPLGTLAEELSSYSRRKGGFSFRFGR",
                "length": 124
            },
            "evidence": [
                {
                    "id": "Q8CE23",
                    "url": "https://omabrowser.org/oma/group/Q8CE23/",
                    "database": "OMA"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "extracellular region",
                        "id": "GO:0005576",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8CE23",
                                "url": "https://www.uniprot.org/uniprot/Q8CE23"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 5,
                "go_terms": [
                    {
                        "name": "neuropeptide signaling pathway",
                        "id": "GO:0007218",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007218",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8CE23",
                                "url": "https://www.uniprot.org/uniprot/Q8CE23"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "locomotory behavior",
                        "id": "GO:0007626",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007626",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8CE23",
                                "url": "https://www.uniprot.org/uniprot/Q8CE23"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of blood pressure",
                        "id": "GO:0045777",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045777",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8CE23",
                                "url": "https://www.uniprot.org/uniprot/Q8CE23"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of feeding behavior",
                        "id": "GO:0060259",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060259",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8CE23",
                                "url": "https://www.uniprot.org/uniprot/Q8CE23"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "grooming behavior",
                        "id": "GO:0007625",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007625",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8CE23",
                                "url": "https://www.uniprot.org/uniprot/Q8CE23"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 2,
                "go_terms": [
                    {
                        "name": "neuropeptide hormone activity",
                        "id": "GO:0005184",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005184",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8CE23",
                                "url": "https://www.uniprot.org/uniprot/Q8CE23"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "orexigenic neuropeptide QRFP receptor binding",
                        "id": "GO:0031854",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031854",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8CE23",
                                "url": "https://www.uniprot.org/uniprot/Q8CE23"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 7
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}