{ "uniprot_canonical_ac": "Q8CDI2-1", "uniprot_ac": "Q8CDI2", "uniprot_id": "FBX43_MOUSE", "mass": { "chemical_mass": 71171.0, "monoisotopic_mass": 71171.0 }, "refseq": { "ac": "NP_001074722", "name": "F-box only protein 43 isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074722" }, "gene_names": [ { "name": "Fbxo43", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8CDI2", "id": "Q8CDI2" }, { "name": "4930533G20Rik; Emi2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074722", "id": "NP_001074722" }, { "name": "Emi2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q8CDI2", "id": "Q8CDI2" }, { "name": "Fbxo43", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074722", "id": "NP_001074722" } ], "protein_names": [ { "name": "F-box only protein 43", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8CDI2" }, { "name": "Endogenous meiotic inhibitor 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8CDI2" }, { "name": "F-box only protein 43 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074722", "id": "NP_001074722" }, { "name": "F-box only protein 43; early mitotic inhibitor 2; XErp1 homolog; endogenous meiotic inhibitor 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074722", "id": "NP_001074722" } ], "function": [ { "annotation": "Besides regulating cell-cycle arrest in mouse eggs, Emi2 is essential for meiosis I progression in spermatocytes. In the absence of Emi2, spermatocytes arrest in early diplotene of prophase I.", "evidence": [ { "database": "RefSeq", "id": "NP_001074722", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074722" }, { "database": "PubMed", "id": "28723571", "url": "https://glygen.org/publication/PubMed/28723571" } ] }, { "annotation": "Cdc2 and Mos regulate Emi2 stability to promote the meiosis I-meiosis II transition", "evidence": [ { "database": "RefSeq", "id": "NP_001074722", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074722" }, { "database": "PubMed", "id": "18550795", "url": "https://glygen.org/publication/PubMed/18550795" } ] }, { "annotation": "Data suggest that the increase of Wee 1 tyrosine kinase but decrease of early mitotic inhibitor 2 level triggers maturation promoting factor (MPF) destabilization and thereby postovulatory aging-mediated abortive spontaneous egg activation in eggs.", "evidence": [ { "database": "RefSeq", "id": "NP_001074722", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074722" }, { "database": "PubMed", "id": "26991553", "url": "https://glygen.org/publication/PubMed/26991553" } ] }, { "annotation": "FBXO43 variants in patients with female infertility characterized by early embryonic arrest.", "evidence": [ { "database": "RefSeq", "id": "NP_001074722", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074722" }, { "database": "PubMed", "id": "34052850", "url": "https://glygen.org/publication/PubMed/34052850" } ] }, { "annotation": "Required to establish and maintain the arrest of oocytes at the second meiotic metaphase until fertilization. Acts by inhibiting the anaphase-promoting complex/cyclosome (APC/C) ubiquitin ligase. Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation (PubMed:16456547). Plays a vital role in modulating the ubiquitilation of CCNB1 and CDK1 during gametogenesis (PubMed:28723571).", "evidence": [ { "database": "UniProtKB", "id": "Q8CDI2", "url": "https://www.uniprot.org/uniprot/Q8CDI2#function" }, { "database": "PubMed", "id": "16456547", "url": "https://glygen.org/publication/PubMed/16456547" }, { "database": "PubMed", "id": "28723571", "url": "https://glygen.org/publication/PubMed/28723571" } ] }, { "annotation": "Separable N- and C-terminal domains of mouse Emi2 modulated metaphase establishment and maintenance, respectively, through indirect and direct mechanisms.", "evidence": [ { "database": "RefSeq", "id": "NP_001074722", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074722" }, { "database": "PubMed", "id": "20724447", "url": "https://glygen.org/publication/PubMed/20724447" } ] } ], "disease": [ { "disease_id": "DOID:0112353", "recommended_name": { "id": "DOID:0112353", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112353", "name": "spermatogenic failure 64", "description": "A spermatogenic failure characterized by male infertility due to oligoasthenoteratozoospermia or nonobstructive azoospermia that has_material_basis_in homozygous or compound heterozygous mutation in the FBXO43 gene on chromosome 8q22.2." }, "synonyms": [ { "id": "DOID:0112353", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112353", "name": "SPGF64", "description": "" }, { "id": "MONDO:0030522", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030522", "name": "spermatogenic failure 64", "description": "" }, { "id": "MONDO:0030522", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030522", "name": "SPGF64", "description": "" }, { "id": "MIM:619696", "resource": "MIM", "url": "https://www.omim.org/entry/619696", "name": "Spermatogenic failure 64", "description": "Spermatogenic failure 64" } ], "evidence": [ { "id": "0112353", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0112353" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8CDI2", "url": "https://www.uniprot.org/uniprot/Q8CDI2" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Fbxo43", "url": "https://www.uniprot.org/uniprot/Q8CDI2", "locus": { "chromosome": "15", "start_pos": 36150206, "end_pos": 36165030, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000048230", "url": "https://www.ensembl.org/id/ENSMUSG00000048230" } ] } } ], "crossref": [ { "id": "ENSMUSG00000048230", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000048230", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd20365", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20365", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "78803", "url": "https://www.ncbi.nlm.nih.gov/gene/78803", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q8CDI2", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q8CDI2*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002867", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002867", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044064", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044064", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047147", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047147", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:78803", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:78803", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1926053", "url": "http://www.informatics.jax.org/marker/MGI:1926053", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "WKVSKNW", "url": "https://omabrowser.org/oma/group/WKVSKNW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3089336at2759", "url": "http://www.orthodb.org/?query=3089336at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15493", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15493", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15493:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15493:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2RT9", "url": "https://www.rcsb.org/structure/2RT9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DMS", "url": "https://www.rcsb.org/structure/5DMS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DMV", "url": "https://www.rcsb.org/structure/5DMV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01485", "url": "http://pfam.xfam.org/family/PF01485", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8CDI2", "url": "http://purl.obolibrary.org/obo/PR_Q8CDI2", "database": "PRO", "categories": [ "Protein" ] }, { "id": "A0A2I3BQX6", "url": "https://www.uniprot.org/uniprot/A0A2I3BQX6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2I3BQX6-1", "url": "https://www.uniprot.org/uniprot/A0A2I3BQX6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3X9B2", "url": "https://www.uniprot.org/uniprot/G3X9B2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3X9B2-1", "url": "https://www.uniprot.org/uniprot/G3X9B2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8CDI2", "url": "https://www.uniprot.org/uniprot/Q8CDI2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8CDI2-1", "url": "https://www.uniprot.org/uniprot/Q8CDI2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDSSAVTVKGLSLIDFCSTSSFKYRGHHELSESCSLNKKEEEPMLTCEHPETPSLGSPNSAVSPSQIMKSVSLRKEKDKSPELCETPKLRRKKCTLRRRLDFSFPLLKGDSDSQSRSLESNISQGVSLEKHLPGSTSGFPKEDNFSPLVTSTIKTEDVVSNSQNSRLHFSQHKTSTIEDSKDNCGLFEVECLSPIEGNDFKDSITHFSDSSLSVSDENTCPELLGSCGSQTTYGADVTTSVTPVSSLIAKIKFNGNQTLDSSGEVRDSLFTPEDSGFCSLSWDKSEDFLSDQEGSFQELLQKHRVTPKVGDQVKKPKHFGRLRRLSTLQEQGQSEDEMQTVHPNSDSGVLESLQGSEEKRGNLALSFKDLSNTPALQLVQELFMKSKRKRSQQEDDQEFFEDRDEGKIARLQRVLAGLIGKKMGIEQLDILTELQYRNLKHILAMVLESLTSESLYSAWNVSRNWREIVAQDKKANRRRKLYIIQLRASAQGAAVLRVQDAATRLCLLSRLALRSVQAQAQAPSGEQVPTLSPWGDVLTPVASSSLTHLRSKQEQYVKVARTLFTDEALKPCPRCQSPAKYQPHKKRGLCSRLACGFDFCVLCLCAYHGSEDCRRGSAKARGSKDVLPGSAQSKRNLKRL", "length": 640, "header": "sp|Q8CDI2-1|FBX43_MOUSE Isoform 1 of F-box only protein 43 OS=Mus musculus OX=10090 GN=Fbxo43 PE=1 SV=2 CANONICAL=Q8CDI2-1" }, "isoforms": [ { "isoform_ac": "A0A2I3BQX6-1", "url": "", "sequence": { "sequence": "MDSSAVTVKGLSLIDFCSTSSFKYRGHHELSESCSLNKKEEEPMLTCEHPETPSLGSPNSAVSPSQIMKSVSLRKEKDKSPELCETPKLRRKKCTLRRRLDFSFPLLKGDSDSQSRSLESNISQGVSLEKHLPGSTSGFPKEDNFSPLVTSTIKTEDVVSNS", "length": 162, "header": "tr|A0A2I3BQX6-1|A0A2I3BQX6_MOUSE Computationally mapped isoform of F-box protein 43 OS=Mus musculus OX=10090 GN=Fbxo43 PE=1 SV=1 CANONICAL=Q8CDI2-1" }, "locus": { "chromosome": "15", "start_pos": 36163205, "end_pos": 36162720, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000227793.2", "url": "https://www.ensembl.org/id/ENSMUST00000227793.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000154351.2", "url": "https://www.ensembl.org/id/ENSMUSP00000154351.2" } ] } }, { "isoform_ac": "G3X9B2-1", "url": "", "sequence": { "sequence": "MDSSAVTVKGLSLIDFCSTSSFKYRGHHELSESCSLNKKEEEPMLTCEHPETPSLGSPNSAVSPSQIMKSVSLRKEKDKSPELCETPKLRRKKCTLRRRLDFSFPLLKGDSDSQSRSLESNISQGVSLEKHLPGSTSGFPKEDNFSPLVTSTIKTEDVVSNSQNSRLHFSQHKTSTIEDSKDNCGLFEVECLSPIEGNDFKDSITHFSDSSLSVSDENTCPELLGSCGSQTTYGADVTTSVTPVSSLIAKIKFNGNQTLDSSGEVRDSLFTPEDSGFCSLSWDKSEDFLSDQEGSFQELLQKHRVTPKVGDQVKKPKHFGRLRRLSTLQEQGSQSEDEMQTVHPNSDSGVLESLQGSEEKRGNLALSFKDLSNTPALQLVQELFMKSKRKRSQQEDDQEFFEDRDEGKIARLQRVLAGLIGKKMGIEQLDILTELQYRNLKHILAMVLESLTSESLYSAWNVSRNWREIVAQDKKANRRRKLYIIQLRASAQGAAVLRVQDAATRLCLLSRLALRSVQAQAQAPSGEQVPTLSPWGDVLTPVASSSLTHLRSKQEQYVKVARTLFTDEALKPCPRCQSPAKYQPHKKRGLCSRLACGFDFCVLCLCAYHGSEDCRRGSAKARGSKDVLPGSAQSKRNLKRL", "length": 641, "header": "tr|G3X9B2-1|FBX43_MOUSE Computationally mapped isoform of F-box only protein 43 OS=Mus musculus OX=10090 GN=Fbxo43 PE=1 SV=1 CANONICAL=Q8CDI2-1" }, "locus": { "chromosome": "15", "start_pos": 36163205, "end_pos": 36151793, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000058643.4", "url": "https://www.ensembl.org/id/ENSMUST00000058643.4" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000054125.4", "url": "https://www.ensembl.org/id/ENSMUSP00000054125.4" } ] } }, { "isoform_ac": "Q8CDI2-1", "url": "", "sequence": { "sequence": "MDSSAVTVKGLSLIDFCSTSSFKYRGHHELSESCSLNKKEEEPMLTCEHPETPSLGSPNSAVSPSQIMKSVSLRKEKDKSPELCETPKLRRKKCTLRRRLDFSFPLLKGDSDSQSRSLESNISQGVSLEKHLPGSTSGFPKEDNFSPLVTSTIKTEDVVSNSQNSRLHFSQHKTSTIEDSKDNCGLFEVECLSPIEGNDFKDSITHFSDSSLSVSDENTCPELLGSCGSQTTYGADVTTSVTPVSSLIAKIKFNGNQTLDSSGEVRDSLFTPEDSGFCSLSWDKSEDFLSDQEGSFQELLQKHRVTPKVGDQVKKPKHFGRLRRLSTLQEQGQSEDEMQTVHPNSDSGVLESLQGSEEKRGNLALSFKDLSNTPALQLVQELFMKSKRKRSQQEDDQEFFEDRDEGKIARLQRVLAGLIGKKMGIEQLDILTELQYRNLKHILAMVLESLTSESLYSAWNVSRNWREIVAQDKKANRRRKLYIIQLRASAQGAAVLRVQDAATRLCLLSRLALRSVQAQAQAPSGEQVPTLSPWGDVLTPVASSSLTHLRSKQEQYVKVARTLFTDEALKPCPRCQSPAKYQPHKKRGLCSRLACGFDFCVLCLCAYHGSEDCRRGSAKARGSKDVLPGSAQSKRNLKRL", "length": 640, "header": "sp|Q8CDI2-1|FBX43_MOUSE Isoform 1 of F-box only protein 43 OS=Mus musculus OX=10090 GN=Fbxo43 PE=1 SV=2 CANONICAL=Q8CDI2-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 176, "end_pos": 176, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q8CDI2", "url": "https://www.uniprot.org/uniprot/Q8CDI2" } ], "site_lbl": "Thr176" }, { "start_pos": 275, "end_pos": 275, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q8CDI2", "url": "https://www.uniprot.org/uniprot/Q8CDI2" } ], "site_lbl": "Ser275" }, { "start_pos": 436, "end_pos": 436, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q8CDI2", "url": "http://phospho.elm.eu.org/byAccession/Q8CDI2.html" }, { "database": "iPTMnet", "id": "Q8CDI2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8CDI2" }, { "database": "PubMed", "id": "17203969", "url": "https://glygen.org/publication/PubMed/17203969" } ], "site_lbl": "Tyr436" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Mammalian Emi2 mediates cytostatic arrest and transduces the signal for meiotic exit via Cdc20.", "journal": "EMBO J.", "date": "2006", "authors": "Fukui T., Nakano Y., Yoshida N., Fujimoto S., Perry A.C.F., Kajikawa E., Shoji S., Amanai M., Ohgishi M.", "evidence": [ { "database": "UniProtKB", "id": "Q8CDI2", "url": "https://www.uniprot.org/uniprot/Q8CDI2" } ], "reference": [ { "type": "PubMed", "id": "16456547", "url": "https://glygen.org/publication/PubMed/16456547" } ] }, { "title": "Protein phosphorylation and expression profiling by Yin-yang multidimensional liquid chromatography (Yin-yang MDLC) mass spectrometry.", "journal": "Journal of proteome research", "date": "2007", "authors": "Dai J, Jin WH, Sheng QH, Shieh CH, Wu JR, Zeng R", "evidence": [ { "database": "iPTMnet", "id": "Q8CDI2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8CDI2" } ], "reference": [ { "type": "PubMed", "id": "17203969", "url": "https://glygen.org/publication/PubMed/17203969" } ] }, { "title": "Cdc2 and Mos regulate Emi2 stability to promote the meiosis I-meiosis II transition.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Tang W, Wu JQ, Guo Y, Hansen DV, Perry JA, Freel CD, Nutt L, Jackson PK, Kornbluth S", "evidence": [ { "database": "RefSeq", "id": "NP_001074722", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074722" } ], "reference": [ { "type": "PubMed", "id": "18550795", "url": "https://glygen.org/publication/PubMed/18550795" } ] }, { "title": "Mouse Emi2 as a distinctive regulatory hub in second meiotic metaphase.", "journal": "Development (Cambridge, England)", "date": "2010", "authors": "Suzuki T, Suzuki E, Yoshida N, Kubo A, Li H, Okuda E, Amanai M, Perry AC", "evidence": [ { "database": "RefSeq", "id": "NP_001074722", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074722" } ], "reference": [ { "type": "PubMed", "id": "20724447", "url": "https://glygen.org/publication/PubMed/20724447" } ] }, { "title": "Maturation promoting factor destabilization facilitates postovulatory aging-mediated abortive spontaneous egg activation in rat.", "journal": "Development, growth & differentiation", "date": "2016", "authors": "Prasad S, Koch B, Chaube SK", "evidence": [ { "database": "RefSeq", "id": "NP_001074722", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074722" } ], "reference": [ { "type": "PubMed", "id": "26991553", "url": "https://glygen.org/publication/PubMed/26991553" } ] }, { "title": "Emi2 Is Essential for Mouse Spermatogenesis.", "journal": "Cell Rep.", "date": "2017", "authors": "Gopinathan L, Szmyd R, Low D, Diril MK, Chang HY, Coppola V, Liu K, Tessarollo L, Guccione E, van Pelt AMM, Kaldis P", "evidence": [ { "database": "UniProtKB", "id": "Q8CDI2", "url": "https://www.uniprot.org/uniprot/Q8CDI2" }, { "database": "RefSeq", "id": "NP_001074722", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074722" } ], "reference": [ { "type": "PubMed", "id": "28723571", "url": "https://glygen.org/publication/PubMed/28723571" } ] }, { "title": "FBXO43 variants in patients with female infertility characterized by early embryonic arrest.", "journal": "Human reproduction (Oxford, England)", "date": "2021", "authors": "Wang W, Wang W, Xu Y, Shi J, Fu J, Chen B, Mu J, Zhang Z, Zhao L, Lin J, Du J, Li Q, He L, Jin L, Sun X, Wang L, Sang Q", "evidence": [ { "database": "RefSeq", "id": "NP_001074722", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074722" } ], "reference": [ { "type": "PubMed", "id": "34052850", "url": "https://glygen.org/publication/PubMed/34052850" } ] } ], "pathway": [ { "id": "mmu:78803", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:78803", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q4G163-1", "protein_name": "F-box only protein 43", "gene_name": "FBXO43", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSFKDKDERISCLEAYVTLTSKSSRFTDETEILKMSQRHSGQAGTEAGNGADSPPIVNSKYSTFRDFCSTSSFQDSGYNELKSCSFDNIDKEYLGKKEKGPTLLYEHPETSGLGLTHPLESPTQKKKCILPRKEKDKTPELCETPKISGKKCLPRRRLNVSFALLKGDFESQNSSLESSISQVINLEKNIPSSASGFSRANNFSPLVTSTLKTEEVTSCSQKLRLNFSQQKTSTIDDSKDDCSLFEVECISPIQGNNFKDSITHDFSDSSLCINDENACPELLGSSVSGTTCGTDEDIFVTPISNLVANIRFNASQILSPSPEVRGSISTPEDSGFNSLSLEKSEDSLSDQEGSFQELLQKHKGTPKVGDTIRKTRHLGRSRRLSTLREQSSQSETEEEKQIVHPDSEKRAAAASAISEGQLSSDESGDLTFSLKNLSKTPALQLVHELFMKSKRKRLQENSGHEFLEQGDGEKIAVLQCILAGLIGKKMGIEKLDILTELKYRNLKHILAMVLESLTAESLCSVWKVSRNWREIVVQDKNANRRRKFYITQLKTDSEGAVLNVEDAATRLQLLNRSALRSVQAQARIPGSQREQGSTLSPWGEVLTPLASSSVTHLSSKQEEYVKVAKTLFTDEALKPCPRCQSPAKYQPYKKRGLCSRTACGFDFCVLCLCAYHGSEECSRGAAKPRNRKDALPGSAQSKRNLKRL", "length": 708 }, "evidence": [ { "id": "45238898", "url": "http://www.informatics.jax.org/homology/45238898", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q66H04-1", "protein_name": "F-box only protein 43", "gene_name": "Fbxo43", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPQKHSASHRAGSNMGSSAVTVRCPSLPDFGPTSSFKHRGPHELSETCSFSKKEKDPMLTCEHLETPRLGFPNPAVSPSPRKKSVSLRKEKEESPELCETPKLRRKKCTLRRRLDLTLTLLKGDSDSQSSSLESNISHSLSLEKRLRDSTSGFPKEDNFSPLVTSTVKTEDAISSSQNSRLHFSQHKTSTIDDSKDDCGLFEVECLSPIEGNDFKDSVTHFSDSGLSASDENTCPELLGSSGSQTTYGADVTTSVTPVSSLIAKIKFHGSQTLASSAEVRDSLSTPEDSGFCSLSWDKSEDFLSDQEGSFQELQKHRGTPTVGDLVRQPKHPGRLRRLPTLQEQGSQSETDDEMQVAHPSAGVRVGTASGVLESQQGSEEKSGDLTLSFKDLSNTPALQLVCELFMKSKRKRFEQADDQEFSEEREEGKIARLQHVLAGLIGKKMGIERLDILTELQYRNLKHILAMVLDSLTAESLYSAWNVSRNWRGIVAQDKRANRRRKLFIAQLKAKAQGAAVLRVQDAATRLRLLSRLALRSVQAQAQAPNGQNEQAPAQSPWGEVLTPVASSSLTHLRSKQEQYLKVARTLFTDEALKPCPRCQSPAKYQPHKKRGLCSRLACGFDFCVLCLCAYHGSEDCRRGSAKGRGSRDVLPGSAQSKRNLKRL", "length": 664 }, "evidence": [ { "id": "45238898", "url": "http://www.informatics.jax.org/homology/45238898", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "negative regulation of cell cycle process", "id": "GO:0010948", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010948", "evidence": [ { "database": "UniProtKB", "id": "Q8CDI2", "url": "https://www.uniprot.org/uniprot/Q8CDI2" } ], "pmid": "" }, { "name": "protein ubiquitination", "id": "GO:0016567", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", "evidence": [ { "database": "UniProtKB", "id": "Q8CDI2", "url": "https://www.uniprot.org/uniprot/Q8CDI2" } ], "pmid": "" }, { "name": "negative regulation of protein catabolic process", "id": "GO:0042177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042177", "evidence": [ { "database": "UniProtKB", "id": "Q8CDI2", "url": "https://www.uniprot.org/uniprot/Q8CDI2" } ], "pmid": "" }, { "name": "protein catabolic process", "id": "GO:0030163", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030163", "evidence": [ { "database": "UniProtKB", "id": "Q8CDI2", "url": "https://www.uniprot.org/uniprot/Q8CDI2" } ], "pmid": "" }, { "name": "regulation of mitotic nuclear division", "id": "GO:0007088", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007088", "evidence": [ { "database": "UniProtKB", "id": "Q8CDI2", "url": "https://www.uniprot.org/uniprot/Q8CDI2" } ], "pmid": "" }, { "name": "negative regulation of meiotic nuclear division", "id": "GO:0045835", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045835", "evidence": [ { "database": "UniProtKB", "id": "Q8CDI2", "url": "https://www.uniprot.org/uniprot/Q8CDI2" } ], "pmid": "" }, { "name": "regulation of meiotic nuclear division", "id": "GO:0040020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0040020", "evidence": [ { "database": "UniProtKB", "id": "Q8CDI2", "url": "https://www.uniprot.org/uniprot/Q8CDI2" } ], "pmid": "" }, { "name": "meiotic nuclear division", "id": "GO:0140013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140013", "evidence": [ { "database": "UniProtKB", "id": "Q8CDI2", "url": "https://www.uniprot.org/uniprot/Q8CDI2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q8CDI2", "url": "https://www.uniprot.org/uniprot/Q8CDI2" } ], "pmid": "" }, { "name": "female germ cell nucleus", "id": "GO:0001674", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001674", "evidence": [ { "database": "UniProtKB", "id": "Q8CDI2", "url": "https://www.uniprot.org/uniprot/Q8CDI2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "Q8CDI2", "url": "https://www.uniprot.org/uniprot/Q8CDI2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 121, "end_pos": 123, "annotation": "n_glycosylation_sequon" }, { "start_pos": 144, "end_pos": 146, "annotation": "n_glycosylation_sequon" }, { "start_pos": 256, "end_pos": 258, "annotation": "n_glycosylation_sequon" }, { "start_pos": 460, "end_pos": 462, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }