{ "uniprot_canonical_ac": "Q8CAV0-1", "uniprot_ac": "Q8CAV0", "uniprot_id": "YBEY_MOUSE", "mass": { "chemical_mass": 18989.0, "monoisotopic_mass": 18989.0 }, "refseq": { "ac": "NP_766138", "name": "endoribonuclease YbeY", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766138" }, "gene_names": [ { "name": "Ybey", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8CAV0", "id": "Q8CAV0" }, { "name": "1110068N23Rik; A130042E20Rik; C21orf57; ORF57; ORF66", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766138", "id": "NP_766138" }, { "name": "Ybey", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766138", "id": "NP_766138" } ], "protein_names": [ { "name": "Endoribonuclease YbeY", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8CAV0" }, { "name": "3.1.-.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8CAV0" }, { "name": "endoribonuclease YbeY", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766138", "id": "NP_766138" }, { "name": "putative metalloprotease C21orf57 homolog; rRNA maturation factor homolog; putative ribonuclease", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766138", "id": "NP_766138" } ], "function": [ { "annotation": "Single strand-specific metallo-endoribonuclease involved in rRNA maturation.", "evidence": [ { "database": "UniProtKB", "id": "Q8CAV0", "url": "https://www.uniprot.org/uniprot/Q8CAV0#function" }, { "database": "UniProtKB", "id": "P58557", "url": "https://www.uniprot.org/uniprot/P58557#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8CAV0", "url": "https://www.uniprot.org/uniprot/Q8CAV0" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Ybey", "url": "https://www.uniprot.org/uniprot/Q8CAV0", "locus": { "chromosome": "10", "start_pos": 76295401, "end_pos": 76304948, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000033126", "url": "https://www.ensembl.org/id/ENSMUSG00000033126" } ] } } ], "crossref": [ { "id": "ENSMUSG00000033126", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000033126", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "216119", "url": "https://www.ncbi.nlm.nih.gov/gene/216119", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q8CAV0", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q8CAV0*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002036", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002036", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020549", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020549", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023091", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023091", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:216119", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:216119", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2656825", "url": "http://www.informatics.jax.org/marker/MGI:2656825", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "QFDLGVI", "url": "https://omabrowser.org/oma/group/QFDLGVI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "386967at2759", "url": "http://www.orthodb.org/?query=386967at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46986", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46986", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46986:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46986:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02130", "url": "http://pfam.xfam.org/family/PF02130", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8CAV0", "url": "http://purl.obolibrary.org/obo/PR_Q8CAV0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_766138", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766138", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q8CAV0", "url": "https://www.uniprot.org/uniprot/Q8CAV0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8CAV0-1", "url": "https://www.uniprot.org/uniprot/Q8CAV0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSLVIKNLQRVVPIRRVPLRRKMDLVRSILGVKKFDLGIICVDNKTIQNINRIYRNKNVPTDVLSFSFHENLKAGEFPQPHSPDDYNLGDIFLGVEYILQHCRESEDYCDVLTVTATHGLCHLLGFTHSSKAEWQKMYNQEKLVLEELSRYTGARLQPLSRGLY", "length": 164, "header": "sp|Q8CAV0-1|YBEY_MOUSE Isoform 1 of Endoribonuclease YbeY OS=Mus musculus OX=10090 GN=Ybey PE=1 SV=1 CANONICAL=Q8CAV0-1" }, "isoforms": [ { "isoform_ac": "Q8CAV0-1", "url": "", "sequence": { "sequence": "MSLVIKNLQRVVPIRRVPLRRKMDLVRSILGVKKFDLGIICVDNKTIQNINRIYRNKNVPTDVLSFSFHENLKAGEFPQPHSPDDYNLGDIFLGVEYILQHCRESEDYCDVLTVTATHGLCHLLGFTHSSKAEWQKMYNQEKLVLEELSRYTGARLQPLSRGLY", "length": 164, "header": "sp|Q8CAV0-1|YBEY_MOUSE Isoform 1 of Endoribonuclease YbeY OS=Mus musculus OX=10090 GN=Ybey PE=1 SV=1 CANONICAL=Q8CAV0-1" }, "locus": { "chromosome": "10", "start_pos": 76304200, "end_pos": 76299070, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000049185", "url": "https://www.ensembl.org/id/ENSMUST00000049185" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000045647", "url": "https://www.ensembl.org/id/ENSMUSP00000045647" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "mmu:216119", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:216119", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D4A815-1", "protein_name": "YbeY metalloendoribonuclease", "gene_name": "Ybey", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSLVIKNLQRVVPIRRMPLRRKMDLVRSILGVKKFDLGIICVDNKNIQNINRIYRNKNVPTDVLSFPFHENLKAGEFPQPRSPDDYNLGDVFLGVEYIFQYCKGNEDYYDVLTVTATHGLCHLLGFTHSSEAEWQKMYNQEKLVLEELSRHTGARLQPLSRGLY", "length": 164 }, "evidence": [ { "id": "45236318", "url": "http://www.informatics.jax.org/homology/45236318", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P58557-1", "protein_name": "Endoribonuclease YbeY", "gene_name": "YBEY", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSLVIRNLQRVIPIRRAPLRSKIEIVRRILGVQKFDLGIICVDNKNIQHINRIYRDRNVPTDVLSFPFHEHLKAGEFPQPDFPDDYNLGDIFLGVEYIFHQCKENEDYNDVLTVTATHGLCHLLGFTHGTEAEWQQMFQKEKAVLDELGRRTGTRLQPLTRGLFGGS", "length": 167 }, "evidence": [ { "id": "45236318", "url": "http://www.informatics.jax.org/homology/45236318", "database": "MGI" }, { "id": "Q8CAV0", "url": "https://omabrowser.org/oma/group/Q8CAV0/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "metalloendopeptidase activity", "id": "GO:0004222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004222", "evidence": [ { "database": "UniProtKB", "id": "Q8CAV0", "url": "https://www.uniprot.org/uniprot/Q8CAV0" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q8CAV0", "url": "https://www.uniprot.org/uniprot/Q8CAV0" } ], "pmid": "" }, { "name": "RNA endonuclease activity", "id": "GO:0004521", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004521", "evidence": [ { "database": "UniProtKB", "id": "Q8CAV0", "url": "https://www.uniprot.org/uniprot/Q8CAV0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q8CAV0", "url": "https://www.uniprot.org/uniprot/Q8CAV0" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q8CAV0", "url": "https://www.uniprot.org/uniprot/Q8CAV0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "rRNA processing", "id": "GO:0006364", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006364", "evidence": [ { "database": "UniProtKB", "id": "Q8CAV0", "url": "https://www.uniprot.org/uniprot/Q8CAV0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 44, "end_pos": 46, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }