{
    "uniprot_canonical_ac": "Q8C5K5-1",
    "uniprot_ac": "Q8C5K5",
    "uniprot_id": "CX038_MOUSE",
    "mass": {
        "chemical_mass": 36589.0,
        "monoisotopic_mass": 36589.0
    },
    "refseq": {
        "ac": "NP_780350",
        "name": "uncharacterized protein CXorf38 homolog",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_780350"
    },
    "gene_names": [
        {
            "name": "1810030O07Rik",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_780350",
            "id": "NP_780350"
        }
    ],
    "protein_names": [
        {
            "name": "Uncharacterized protein CXorf38 homolog",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q8C5K5"
        },
        {
            "name": "uncharacterized protein CXorf38 homolog",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_780350",
            "id": "NP_780350"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8C5K5",
                    "url": "https://www.uniprot.org/uniprot/Q8C5K5"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "",
            "url": "https://www.uniprot.org/uniprot/Q8C5K5",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000044148",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000044148",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "69155",
            "url": "https://www.ncbi.nlm.nih.gov/gene/69155",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR027897",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR027897",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:69155",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:69155",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "1916405",
            "url": "http://www.informatics.jax.org/marker/MGI:1916405",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "LQHQKPD",
            "url": "https://omabrowser.org/oma/group/LQHQKPD/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5302062at2759",
            "url": "http://www.orthodb.org/?query=5302062at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR35083",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR35083",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR35083:SF1",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR35083:SF1",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF15112",
            "url": "http://pfam.xfam.org/family/PF15112",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q8C5K5",
            "url": "http://purl.obolibrary.org/obo/PR_Q8C5K5",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_780350",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_780350",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8C5K5",
            "url": "https://www.uniprot.org/uniprot/Q8C5K5",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8C5K5-1",
            "url": "https://www.uniprot.org/uniprot/Q8C5K5-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8C5K5-2",
            "url": "https://www.uniprot.org/uniprot/Q8C5K5-2",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MVVSELAARLNCAEYKNWVKAGHCLLLLRSCLQGFIDREVLSFHRGLLAAVPGLGPHATCRGGSRCSPRARQFQPQCQVCAEWKHEILRHHINRNGDVHWGNCKPGLWPKDPWEVAKAFMPRGLADKRGPEECDAVALLSLINSCDHFVVDRKKVTEVIKCRNEIMHSSEMKVSSTWLRDFQIKIQNFLNEFKNIPEIVAVYSRIEQLLTSDWAVHIPEEDERDGCEFEIGSYLSVSQIHEIEIELLKEKLQEMYLQAAEEEMLPEEISNQLDVVKGFLGSNTDLRNGLTEDLQKLESLHLQHQKQTSKDAGRQTPERKA",
        "length": 320,
        "header": "sp|Q8C5K5-1|CX038_MOUSE Isoform 1 of Uncharacterized protein CXorf38 homolog  OS=Mus musculus OX=10090 GN= PE=1 SV=1 CANONICAL=Q8C5K5-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q8C5K5-1",
            "url": "",
            "sequence": {
                "sequence": "MVVSELAARLNCAEYKNWVKAGHCLLLLRSCLQGFIDREVLSFHRGLLAAVPGLGPHATCRGGSRCSPRARQFQPQCQVCAEWKHEILRHHINRNGDVHWGNCKPGLWPKDPWEVAKAFMPRGLADKRGPEECDAVALLSLINSCDHFVVDRKKVTEVIKCRNEIMHSSEMKVSSTWLRDFQIKIQNFLNEFKNIPEIVAVYSRIEQLLTSDWAVHIPEEDERDGCEFEIGSYLSVSQIHEIEIELLKEKLQEMYLQAAEEEMLPEEISNQLDVVKGFLGSNTDLRNGLTEDLQKLESLHLQHQKQTSKDAGRQTPERKA",
                "length": 320,
                "header": "sp|Q8C5K5-1|CX038_MOUSE Isoform 1 of Uncharacterized protein CXorf38 homolog  OS=Mus musculus OX=10090 GN= PE=1 SV=1 CANONICAL=Q8C5K5-1"
            },
            "locus": {
                "chromosome": "X",
                "start_pos": 12539780,
                "end_pos": 12524105,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000060108",
                        "url": "https://www.ensembl.org/id/ENSMUST00000060108"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000059095",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000059095"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q8C5K5-2",
            "url": "",
            "sequence": {
                "sequence": "MPRGLADKRGPEECDAVALLSLINSCDHFVVDRKKVTEVIKCRNEIMHSSEMKVSSTWLRDFQIKIQNFLNEFKNIPEIVAVYSRIEQLLTSDWAVHIPEEDERDGCEFEIGSYLSVSQIHEIEIELLKEKLQEMYLQAAEEEMLPEEISNQLDVVKGFLGSNTDLRNGLTEDLQKLESLHLQHQKQTSKDAGRQTPERKA",
                "length": 201,
                "header": "sp|Q8C5K5-2|CX038_MOUSE Isoform 2 of Uncharacterized protein CXorf38 homolog  OS=Mus musculus OX=10090 GN= PE=1 SV=1 CANONICAL=Q8C5K5-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [],
    "phosphorylation": [
        {
            "start_pos": 315,
            "end_pos": 315,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Thr",
            "comment": "Phosphothreonine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8C5K5",
                    "url": "https://www.uniprot.org/uniprot/Q8C5K5"
                }
            ],
            "site_lbl": "Thr315"
        }
    ],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.",
            "journal": "Mol. Cell. Proteomics",
            "date": "2014",
            "authors": "Guo A, Gu H, Zhou J, Mulhern D, Wang Y, Lee KA, Yang V, Aguiar M, Kornhauser J, Jia X, Ren J, Beausoleil SA, Silva JC, Vemulapalli V, Bedford MT, Comb MJ",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8C5K5",
                    "url": "https://www.uniprot.org/uniprot/Q8C5K5"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24129315",
                    "url": "https://glygen.org/publication/PubMed/24129315"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:69155",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:69155",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "B1WBZ6-1",
            "protein_name": "RGD1565685 protein",
            "gene_name": "RGD1565685",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MVLSELAARLNCAEYKNWVKAGQCLLLLRSCLQGFVNREVLSFHRGLLIAVPGLGPQATCRGGSRCSPRARQFQPHCQVCTDWKREILRHHINRNGDVHWGNCRPGLWPVDPWEVAKAFMPRGLADKRGPEECDAVALLSLINSCDHFVVDRKKVTEVIKCRNEIMHSSEMKVSSTWLRDFQIKIQNFLYEFKNIPEIVAVYSRIEQLLTSDWAVHIPEEDERDGCEFETESYLSVSQIHEIEIELLKEKLQEMYLQAAAEEVLSEEISNQLDVVKGFLQSNTDLRNALTEDLQKLDSLHLQHQKQISKDAGSQTPERKT",
                "length": 320
            },
            "evidence": [
                {
                    "id": "45239412",
                    "url": "http://www.informatics.jax.org/homology/45239412",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        },
        {
            "uniprot_canonical_ac": "Q8TB03-1",
            "protein_name": "Uncharacterized protein CXorf38",
            "gene_name": "CXorf38",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MVLSELAARLNCAEYKNWVKAGHCLLLLRSCLQGFVGREVLSFHRGLLAAAPGLGPRAVCRGGSRCSPRARQFQPQCQVCAEWKREILRHHVNRNGDVHWGNCRPGRWPVDAWEVAKAFMPRGLADKQGPEECDAVALLSLINSCDHFVVDRKKVTEVIKCRNEIMHSSEMKVSSTWLRDFQMKIQNFLNEFKNIPEIVAVYSRIEQLLTSDWAVHIPEEDQRDGCECEMGTYLSESQVNEIEMQLLKEKLQEIYLQAEEQEVLPEELSNRLEVVKEFLRNNEDLRNGLTEDMQKLDSLCLHQKLDSQEPGRQTPDRKA",
                "length": 319
            },
            "evidence": [
                {
                    "id": "45239412",
                    "url": "http://www.informatics.jax.org/homology/45239412",
                    "database": "MGI"
                },
                {
                    "id": "Q8C5K5",
                    "url": "https://omabrowser.org/oma/group/Q8C5K5/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {},
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}