{ "uniprot_canonical_ac": "Q8C0Y1-1", "uniprot_ac": "Q8C0Y1", "uniprot_id": "TGIF2_MOUSE", "mass": { "chemical_mass": 25933.0, "monoisotopic_mass": 25933.0 }, "refseq": { "ac": "NP_001278053", "name": "homeobox protein TGIF2 isoform b", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053" }, "gene_names": [ { "name": "Tgif2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8C0Y1", "id": "Q8C0Y1" }, { "name": "4921501K24; 5730599O09Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053", "id": "NP_001278053" }, { "name": "Tgif2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053", "id": "NP_001278053" } ], "protein_names": [ { "name": "Homeobox protein TGIF2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8C0Y1" }, { "name": "5'-TG-3'-interacting factor 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8C0Y1" }, { "name": "TGF-beta-induced transcription factor 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8C0Y1" }, { "name": "TGFB-induced factor 2; homeobox protein TGIF2; 5'-TG-3'-interacting factor 2; TGF-beta-induced transcription factor 2; TALE family homeobox", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053", "id": "NP_001278053" }, { "name": "TGFB-induced factor 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8C0Y1" }, { "name": "homeobox protein TGIF2 isoform b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053", "id": "NP_001278053" } ], "function": [ { "annotation": "Circular RNA circCPA4 promotes tumorigenesis by regulating miR-214-3p/TGIF2 in lung cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_001278053", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053" }, { "database": "PubMed", "id": "34741437", "url": "https://glygen.org/publication/PubMed/34741437" } ] }, { "annotation": "Downregulation of TGIF2 is possibly correlated with neuronal apoptosis and autism-like symptoms in mice.", "evidence": [ { "database": "RefSeq", "id": "NP_001278053", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053" }, { "database": "PubMed", "id": "35592894", "url": "https://glygen.org/publication/PubMed/35592894" } ] }, { "annotation": "Gm14230 safeguards cellular juvenescence through recruiting the histone methyltransferase Ezh2 to Tgif2, thereby repressing the functional role of Tgif2 in cellular senescence. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001278053", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053" }, { "database": "PubMed", "id": "30872457", "url": "https://glygen.org/publication/PubMed/30872457" } ] }, { "annotation": "TGIF2 has a wide but well controlled expression pattern during mouse development.", "evidence": [ { "database": "RefSeq", "id": "NP_001278053", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053" }, { "database": "PubMed", "id": "15749073", "url": "https://glygen.org/publication/PubMed/15749073" } ] }, { "annotation": "Tgif2 plays an important role in the regulation of osteoblastic differentiation in vitro", "evidence": [ { "database": "RefSeq", "id": "NP_001278053", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053" }, { "database": "PubMed", "id": "31066043", "url": "https://glygen.org/publication/PubMed/31066043" } ] }, { "annotation": "Tgifs play an important role in regulating basic energy metabolism in normal cells, and that this function of Tgifs is amplified in some cancers.", "evidence": [ { "database": "RefSeq", "id": "NP_001278053", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053" }, { "database": "PubMed", "id": "30808659", "url": "https://glygen.org/publication/PubMed/30808659" } ] }, { "annotation": "The Tgif2 gene contains a retained intron, within the second coding exon. One splice variant encodes the full length 237 amino acid Tgif2, whereas the shorter form results in the removal of 39 codons from the centre of the coding region. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001278053", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053" }, { "database": "PubMed", "id": "16436215", "url": "https://glygen.org/publication/PubMed/16436215" } ] }, { "annotation": "Transcriptional repressor, which probably repress transcription by binding directly the 5'-CTGTCAA-3' DNA sequence or by interacting with TGF-beta activated SMAD proteins. Probably represses transcription via the recruitment of histone deacetylase proteins (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Tgif2", "url": "https://www.uniprot.org/uniprot/Q8C0Y1", "locus": { "chromosome": "2", "start_pos": 156697490, "end_pos": 156681927, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000062175", "url": "https://www.ensembl.org/id/ENSMUSG00000062175" } ] } } ], "crossref": [ { "id": "ENSMUSG00000062175", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000062175", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00086", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00086", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "228839", "url": "https://www.ncbi.nlm.nih.gov/gene/228839", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001356", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001356", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008422", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008422", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:228839", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:228839", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1915299", "url": "http://www.informatics.jax.org/marker/MGI:1915299", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "PEWEKPP", "url": "https://omabrowser.org/oma/group/PEWEKPP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3180467at2759", "url": "http://www.orthodb.org/?query=3180467at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11850", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11850", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11850:SF68", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11850:SF68", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF05920", "url": "http://pfam.xfam.org/family/PF05920", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8C0Y1", "url": "http://purl.obolibrary.org/obo/PR_Q8C0Y1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2173795", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001278053", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "H3BJF0", "url": "https://www.uniprot.org/uniprot/H3BJF0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BJF0-1", "url": "https://www.uniprot.org/uniprot/H3BJF0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3TZS1", "url": "https://www.uniprot.org/uniprot/Q3TZS1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3TZS1-1", "url": "https://www.uniprot.org/uniprot/Q3TZS1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8C0Y1-1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSDSDLGEDEGLLSLTGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSLLAVSVPAPTNMLSLSVCSMPLHSGQGEKPAAPFPQVELESPKALVTPASTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKDDFSSFQLLVEVALQRAAEMELQKQQEPAPPLLHTPLPFVSENAK", "length": 237, "header": "sp|Q8C0Y1-1|TGIF2_MOUSE Isoform 1 of Homeobox protein TGIF2 OS=Mus musculus OX=10090 GN=Tgif2 PE=2 SV=1 CANONICAL=Q8C0Y1-1" }, "isoforms": [ { "isoform_ac": "H3BJF0-1", "url": "", "sequence": { "sequence": "MSDSDLGEDEGLLSLTGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQVILT", "length": 68, "header": "tr|H3BJF0-1|H3BJF0_MOUSE Computationally mapped isoform of TGFB-induced factor homeobox 2 OS=Mus musculus OX=10090 GN=Tgif2 PE=4 SV=1 CANONICAL=Q8C0Y1-1" }, "locus": { "chromosome": "2", "start_pos": 156688955, "end_pos": 156686110, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000150078.2", "url": "https://www.ensembl.org/id/ENSMUST00000150078.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000134959.2", "url": "https://www.ensembl.org/id/ENSMUSP00000134959.2" } ] } }, { "isoform_ac": "Q3TZS1-1", "url": "", "sequence": { "sequence": "MSDSDLGEDEGLLSLTGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGQGEKPAAPFPQVELESPKALVTPASTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKDDFSSFQLLVEVALQRAAEMELQKQQEPAPPLLHTPLPFVSENAK", "length": 198, "header": "tr|Q3TZS1-1|Q3TZS1_MOUSE Computationally mapped isoform of TGFB-induced factor homeobox 2 OS=Mus musculus OX=10090 GN=Tgif2 PE=2 SV=1 CANONICAL=Q8C0Y1-1" }, "locus": { "chromosome": "2", "start_pos": 156695567, "end_pos": 156686110, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000073352.10", "url": "https://www.ensembl.org/id/ENSMUST00000073352.10" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000073074.4", "url": "https://www.ensembl.org/id/ENSMUSP00000073074.4" } ] } }, { "isoform_ac": "Q8C0Y1-1", "url": "", "sequence": { "sequence": "MSDSDLGEDEGLLSLTGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSLLAVSVPAPTNMLSLSVCSMPLHSGQGEKPAAPFPQVELESPKALVTPASTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKDDFSSFQLLVEVALQRAAEMELQKQQEPAPPLLHTPLPFVSENAK", "length": 237, "header": "sp|Q8C0Y1-1|TGIF2_MOUSE Isoform 1 of Homeobox protein TGIF2 OS=Mus musculus OX=10090 GN=Tgif2 PE=2 SV=1 CANONICAL=Q8C0Y1-1" }, "locus": { "chromosome": "2", "start_pos": 156695567, "end_pos": 156686110, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000081335", "url": "https://www.ensembl.org/id/ENSMUST00000081335" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000096745", "url": "https://www.ensembl.org/id/ENSMUSP00000096745" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 182, "end_pos": 182, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1" } ], "site_lbl": "Thr182" }, { "start_pos": 186, "end_pos": 186, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1" } ], "site_lbl": "Thr186" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Expression pattern of TG-interacting factor 2 during mouse development.", "journal": "Gene expression patterns : GEP", "date": "2005", "authors": "Jin L, Zhou Y, Kuang C, Lin L, Chen Y", "evidence": [ { "database": "RefSeq", "id": "NP_001278053", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053" } ], "reference": [ { "type": "PubMed", "id": "15749073", "url": "https://glygen.org/publication/PubMed/15749073" } ] }, { "title": "The Tgif2 gene contains a retained intron within the coding sequence.", "journal": "BMC molecular biology", "date": "2006", "authors": "Melhuish TA, Wotton D", "evidence": [ { "database": "RefSeq", "id": "NP_001278053", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053" } ], "reference": [ { "type": "PubMed", "id": "16436215", "url": "https://glygen.org/publication/PubMed/16436215" } ] }, { "title": "TGIF transcription factors repress acetyl CoA metabolic gene expression and promote intestinal tumor growth.", "journal": "Genes & development", "date": "2019", "authors": "Shah A, Melhuish TA, Fox TE, Frierson HF Jr, Wotton D", "evidence": [ { "database": "RefSeq", "id": "NP_001278053", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053" } ], "reference": [ { "type": "PubMed", "id": "30808659", "url": "https://glygen.org/publication/PubMed/30808659" } ] }, { "title": "The juvenility-associated long noncoding RNA Gm14230 maintains cellular juvenescence.", "journal": "Journal of cell science", "date": "2019", "authors": "Tano A, Kadota Y, Morimune T, Jam FA, Yukiue H, Bellier JP, Sokoda T, Maruo Y, Tooyama I, Mori M", "evidence": [ { "database": "RefSeq", "id": "NP_001278053", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053" } ], "reference": [ { "type": "PubMed", "id": "30872457", "url": "https://glygen.org/publication/PubMed/30872457" } ] }, { "title": "TGFbeta-induced factor homeobox 2 blocks osteoblastic differentiation through targeting pSmad3/HDAC4/H4ac/Runx2 axis.", "journal": "Journal of cellular physiology", "date": "2019", "authors": "Yu X, Shen G, Ren H, Zhang Z, Shang Q, Zhao W, Huang J, Yang Z, Liang, Jiang X", "evidence": [ { "database": "RefSeq", "id": "NP_001278053", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053" } ], "reference": [ { "type": "PubMed", "id": "31066043", "url": "https://glygen.org/publication/PubMed/31066043" } ] }, { "title": "Circular RNA circCPA4 promotes tumorigenesis by regulating miR-214-3p/TGIF2 in lung cancer.", "journal": "Thoracic cancer", "date": "2021", "authors": "Tao W, Cao C, Ren G, Zhou D", "evidence": [ { "database": "RefSeq", "id": "NP_001278053", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053" } ], "reference": [ { "type": "PubMed", "id": "34741437", "url": "https://glygen.org/publication/PubMed/34741437" } ] }, { "title": "Downregulation of TGIF2 is possibly correlated with neuronal apoptosis and autism-like symptoms in mice.", "journal": "Brain and behavior", "date": "2022", "authors": "Lei J, Deng Y, Ma S", "evidence": [ { "database": "RefSeq", "id": "NP_001278053", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278053" } ], "reference": [ { "type": "PubMed", "id": "35592894", "url": "https://glygen.org/publication/PubMed/35592894" } ] } ], "pathway": [ { "id": "mmu:228839", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:228839", "resource": "KEGG Pathway" }, { "id": "R-MMU-2173795", "name": "Downregulation of SMAD2/3:SMAD4 transcriptional activity", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2173795", "resource": "Reactome", "description": "Downregulation of SMAD2/3:SMAD4 transcriptional activity" } ], "orthologs": [ { "uniprot_canonical_ac": "A6KIC1-1", "protein_name": "RGD1564927 protein", "gene_name": "RGD1564927", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSDSDLGEDEGLLSLTGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSLLAVSVPAPTNMLSLSVCSMPLHSGQGEKPAASFPQVELESPKALVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKDDFSSFQLLVEVALQRAAEMELQKQQDPAPPLLHTPLPLVSENAK", "length": 237 }, "evidence": [ { "id": "45244005", "url": "http://www.informatics.jax.org/homology/45244005", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9GZN2-1", "protein_name": "Homeobox protein TGIF2", "gene_name": "TGIF2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ", "length": 237 }, "evidence": [ { "id": "45244005", "url": "http://www.informatics.jax.org/homology/45244005", "database": "MGI" }, { "id": "Q8C0Y1", "url": "https://omabrowser.org/oma/group/Q8C0Y1/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1" } ], "pmid": "" }, { "name": "DNA-binding transcription repressor activity, RNA polymerase II-specific", "id": "GO:0001227", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001227", "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1" } ], "pmid": "" }, { "name": "centrosome", "id": "GO:0005813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005813", "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1" } ], "pmid": "" }, { "name": "regulation of gastrulation", "id": "GO:0010470", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010470", "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1" } ], "pmid": "" }, { "name": "positive regulation of amacrine cell differentiation", "id": "GO:1902871", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902871", "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1" } ], "pmid": "" }, { "name": "retina development in camera-type eye", "id": "GO:0060041", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060041", "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1" } ], "pmid": "" }, { "name": "neuron differentiation", "id": "GO:0030182", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030182", "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1" } ], "pmid": "" }, { "name": "nodal signaling pathway", "id": "GO:0038092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038092", "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1" } ], "pmid": "" }, { "name": "amacrine cell differentiation", "id": "GO:0035881", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035881", "evidence": [ { "database": "UniProtKB", "id": "Q8C0Y1", "url": "https://www.uniprot.org/uniprot/Q8C0Y1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 59, "end_pos": 61, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }