{ "uniprot_canonical_ac": "Q8BXK4-1", "uniprot_ac": "Q8BXK4", "uniprot_id": "SAMTR_MOUSE", "mass": { "chemical_mass": 45952.0, "monoisotopic_mass": 45952.0 }, "refseq": { "ac": "NP_780521", "name": "S-adenosylmethionine sensor upstream of mTORC1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_780521" }, "gene_names": [ { "name": "Bmt2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8BXK4", "id": "Q8BXK4" }, { "name": "B630005N14Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_780521", "id": "NP_780521" }, { "name": "B630005N14Rik", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q8BXK4", "id": "Q8BXK4" }, { "name": "Bmt2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_780521", "id": "NP_780521" }, { "name": "Samtor", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q8BXK4", "id": "Q8BXK4" } ], "protein_names": [ { "name": "S-adenosylmethionine sensor upstream of mTORC1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8BXK4" }, { "name": "2.1.1.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8BXK4" }, { "name": "Probable methyltransferase BMT2 homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8BXK4" }, { "name": "S-adenosylmethionine sensor upstream of mTORC1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_780521", "id": "NP_780521" }, { "name": "UPF0532 protein C7orf60 homolog; probable methyltransferase BTM2 homolog; probable methyltransferase BMT2 homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_780521", "id": "NP_780521" } ], "function": [ { "annotation": "S-adenosyl-L-methionine-binding protein that acts as an inhibitor of mTORC1 signaling via interaction with the GATOR1 and KICSTOR complexes. Acts as a sensor of S-adenosyl-L-methionine to signal methionine sufficiency to mTORC1: in presence of methionine, binds S-adenosyl-L-methionine, leading to disrupt interaction with the GATOR1 and KICSTOR complexes and promote mTORC1 signaling. Upon methionine starvation, S-adenosyl-L-methionine levels are reduced, thereby promoting the association with GATOR1 and KICSTOR, leading to inhibit mTORC1 signaling. Probably also acts as a S-adenosyl-L-methionine-dependent methyltransferase.", "evidence": [ { "database": "UniProtKB", "id": "Q8BXK4", "url": "https://www.uniprot.org/uniprot/Q8BXK4#function" }, { "database": "UniProtKB", "id": "MF_03044", "url": "https://www.uniprot.org/uniprot/MF_03044#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BXK4", "url": "https://www.uniprot.org/uniprot/Q8BXK4" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Bmt2", "url": "https://www.uniprot.org/uniprot/Q8BXK4", "locus": { "chromosome": "6", "start_pos": 13625672, "end_pos": 13677965, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000042742", "url": "https://www.ensembl.org/id/ENSMUSG00000042742" } ] } } ], "crossref": [ { "id": "ENSMUSG00000042742", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000042742", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "101148", "url": "https://www.ncbi.nlm.nih.gov/gene/101148", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR021867", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021867", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029063", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029063", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:101148", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:101148", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2141466", "url": "http://www.informatics.jax.org/marker/MGI:2141466", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "ASIMKNW", "url": "https://omabrowser.org/oma/group/ASIMKNW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3669878at2759", "url": "http://www.orthodb.org/?query=3669878at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21008", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21008", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21008:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21008:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF11968", "url": "http://pfam.xfam.org/family/PF11968", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8BXK4", "url": "http://purl.obolibrary.org/obo/PR_Q8BXK4", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9639288", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_780521", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_780521", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0N4SUJ1", "url": "https://www.uniprot.org/uniprot/A0A0N4SUJ1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0N4SUJ1-1", "url": "https://www.uniprot.org/uniprot/A0A0N4SUJ1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8BXK4", "url": "https://www.uniprot.org/uniprot/Q8BXK4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8BXK4-1", "url": "https://www.uniprot.org/uniprot/Q8BXK4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEPGPGGRGAARGQRPPNAAQPREQERKLEQEKLSGVVKSVHRRLRKKYREVGDFDKIWREHCEDAETLCEYAVAMKNLADNHWAKTCEGEGRIEWCCSVCREYFQNGGKRKALEKDEKRAVLATKTTPALNVHESSKLEGPLTNLSFTSPDFITELLQASGKIRLLDVGSCFNPFLKFEEFLTVGIDIVPAVESVYKCDFLNLQLQQPLQLAQDAIDAFLKQLRNPIDALPGELFHVVVFSLLLSYFPSPYQRWICCKKAHELLVLNGLLLIITPDSSHQNRHAMMMKSWKIAIESLGFKRFKYSKFSHMHLMAFRKTSLKTTSDLVSRNYPGMLYIPQDFNSVEEEEYSNTSCYVRSDLEDEQLAYGFTELPEAPYDSDSGESQASSIPFYELEDPILLLS", "length": 403, "header": "sp|Q8BXK4-1|SAMTR_MOUSE Isoform 1 of S-adenosylmethionine sensor upstream of mTORC1 OS=Mus musculus OX=10090 GN=Bmt2 PE=2 SV=2 CANONICAL=Q8BXK4-1" }, "isoforms": [ { "isoform_ac": "A0A0N4SUJ1-1", "url": "", "sequence": { "sequence": "MEPGPGGRGAARGQRPPNAAQPREQERKLEQEKLSGVVKSVHRRLRKKYREVGDFDKIWREHCEDAETLCEYAVAMKNLADNHWAKTCEGEGRIEWCCSVCREYFQNGGKRKALEKDEKRAVLATKTTPALNVHESSKLEGPLTNLSFTSPDFITELLQASGKIRLLDVGSCFNPFLKFEEFLTVGIDIVPAVEVCGFIYRLCF", "length": 204, "header": "tr|A0A0N4SUJ1-1|SAMTR_MOUSE Computationally mapped isoform of S-adenosylmethionine sensor upstream of mTORC1 OS=Mus musculus OX=10090 GN=Bmt2 PE=2 SV=1 CANONICAL=Q8BXK4-1" }, "locus": { "chromosome": "6", "start_pos": 13677832, "end_pos": 13630559, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000203078.2", "url": "https://www.ensembl.org/id/ENSMUST00000203078.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000144704.2", "url": "https://www.ensembl.org/id/ENSMUSP00000144704.2" } ] } }, { "isoform_ac": "Q8BXK4-1", "url": "", "sequence": { "sequence": "MEPGPGGRGAARGQRPPNAAQPREQERKLEQEKLSGVVKSVHRRLRKKYREVGDFDKIWREHCEDAETLCEYAVAMKNLADNHWAKTCEGEGRIEWCCSVCREYFQNGGKRKALEKDEKRAVLATKTTPALNVHESSKLEGPLTNLSFTSPDFITELLQASGKIRLLDVGSCFNPFLKFEEFLTVGIDIVPAVESVYKCDFLNLQLQQPLQLAQDAIDAFLKQLRNPIDALPGELFHVVVFSLLLSYFPSPYQRWICCKKAHELLVLNGLLLIITPDSSHQNRHAMMMKSWKIAIESLGFKRFKYSKFSHMHLMAFRKTSLKTTSDLVSRNYPGMLYIPQDFNSVEEEEYSNTSCYVRSDLEDEQLAYGFTELPEAPYDSDSGESQASSIPFYELEDPILLLS", "length": 403, "header": "sp|Q8BXK4-1|SAMTR_MOUSE Isoform 1 of S-adenosylmethionine sensor upstream of mTORC1 OS=Mus musculus OX=10090 GN=Bmt2 PE=2 SV=2 CANONICAL=Q8BXK4-1" }, "locus": { "chromosome": "6", "start_pos": 13677832, "end_pos": 13628473, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000045235", "url": "https://www.ensembl.org/id/ENSMUST00000045235" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000040578", "url": "https://www.ensembl.org/id/ENSMUSP00000040578" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "mmu:101148", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:101148", "resource": "KEGG Pathway" }, { "id": "R-MMU-9639288", "name": "Amino acids regulate mTORC1", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9639288", "resource": "Reactome", "description": "Amino acids regulate mTORC1" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZV22-1", "protein_name": "S-adenosylmethionine sensor upstream of mTORC1", "gene_name": "Bmt2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEPGPGGRGAARGQRPPNAAQPREQERKLEQEKLSGVVKSVHRRLRKKYREVGDFDKIWREHCEDAETLCEYAVAMKNLADNHWAKTCEGEGRIEWCCSVCREYFQNGGKRKALEKDEKRAVLATKTTPALNVHESSKLEGPLTNLSFTSPEFITELLQASGKIRLLDVGSCFNPFLKFEEFLTVGIDIVPAVESVYKCDFLNLQLQQPLQLAQDAIDAFLKQLKNPIDSLPGELFHVVVFSLLLSYFPSPYQRWICCKKAHELLVLNGLLLIITPDSSHQNRHAMMMKSWKIAIESLGFKRFKYSKFSHMHLMAFRKTSLKTTSDLVSRNYPGMLYIPQDFNSVEDEEYSNPSCYVRSDIEDEQLAYGFTELPDAPYDSDSGESQASSIPFYELEDPILLLS", "length": 403 }, "evidence": [ { "id": "45240125", "url": "http://www.informatics.jax.org/homology/45240125", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q1RMZ1-1", "protein_name": "S-adenosylmethionine sensor upstream of mTORC1", "gene_name": "BMT2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEPGAGGRNTARAQRAGSPNTPPPREQERKLEQEKLSGVVKSVHRRLRKKYREVGDFDKIWREHCEDEETLCEYAVAMKNLADNHWAKTCEGEGRIEWCCSVCREYFQNGGKRKALEKDEKRAVLATKTTPALNMHESSQLEGHLTNLSFTNPEFITELLQASGKIRLLDVGSCFNPFLKFEEFLTVGIDIVPAVESVYKCDFLNLQLQQPLQLAQDAIDAFLKQLKNPIDSLPGELFHVVVFSLLLSYFPSPYQRWICCKKAHELLVLNGLLLIITPDSSHQNRHAMMMKSWKIAIESLGFKRFKYSKFSHMHLMAFRKISLKTTSDLVSRNYPGMLYIPQDFNSIEDEEYSNPSCYVRSDIEDEQLAYGFTELPDAPYDSDSGESQASSIPFYELEDPILLLS", "length": 405 }, "evidence": [ { "id": "45240125", "url": "http://www.informatics.jax.org/homology/45240125", "database": "MGI" }, { "id": "Q8BXK4", "url": "https://omabrowser.org/oma/group/Q8BXK4/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9W138-1", "protein_name": "S-adenosylmethionine sensor upstream of mTORC1", "gene_name": "Samtor", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MATEEHQRLASIVKSCHESLRQLTKEYGATAAWQEHTSPRNAKQLAEYAKAMKQLAAIWETNDGKVELQARSRIKWAIDYITKYFFTEGIYLQKRQREQRLLESYRAEGKLGEVQCRLMEEPPDRLHVLDVGSCFNPFSSAPHLEVTALDLCPATEDVLQADFLKVEVVPGIREPELEEGSVRRLPASHYECVIFSLLLEYMPSAEQRLQCCLQAYDLLLPEGILVLITPDSQHVGKNAHLMKNWRYSLARIGLLRVRFEKLPHISCMVFRKAISRELSQHWASIHREEGMCEEIRIPQDDS", "length": 302 }, "evidence": [ { "id": "Q8BXK4", "url": "https://omabrowser.org/oma/group/Q8BXK4/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "KICSTOR complex", "id": "GO:0140007", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140007", "evidence": [ { "database": "UniProtKB", "id": "Q8BXK4", "url": "https://www.uniprot.org/uniprot/Q8BXK4" } ], "pmid": "" }, { "name": "GATOR1 complex", "id": "GO:1990130", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990130", "evidence": [ { "database": "UniProtKB", "id": "Q8BXK4", "url": "https://www.uniprot.org/uniprot/Q8BXK4" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "methyltransferase activity", "id": "GO:0008168", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008168", "evidence": [ { "database": "UniProtKB", "id": "Q8BXK4", "url": "https://www.uniprot.org/uniprot/Q8BXK4" } ], "pmid": "" }, { "name": "S-adenosyl-L-methionine binding", "id": "GO:1904047", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904047", "evidence": [ { "database": "UniProtKB", "id": "Q8BXK4", "url": "https://www.uniprot.org/uniprot/Q8BXK4" } ], "pmid": "" }, { "name": "transferase activity", "id": "GO:0016740", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016740", "evidence": [ { "database": "UniProtKB", "id": "Q8BXK4", "url": "https://www.uniprot.org/uniprot/Q8BXK4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "methylation", "id": "GO:0032259", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032259", "evidence": [ { "database": "UniProtKB", "id": "Q8BXK4", "url": "https://www.uniprot.org/uniprot/Q8BXK4" } ], "pmid": "" }, { "name": "cellular response to amino acid starvation", "id": "GO:0034198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034198", "evidence": [ { "database": "UniProtKB", "id": "Q8BXK4", "url": "https://www.uniprot.org/uniprot/Q8BXK4" } ], "pmid": "" }, { "name": "negative regulation of TORC1 signaling", "id": "GO:1904262", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904262", "evidence": [ { "database": "UniProtKB", "id": "Q8BXK4", "url": "https://www.uniprot.org/uniprot/Q8BXK4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 145, "end_pos": 147, "annotation": "n_glycosylation_sequon" }, { "start_pos": 352, "end_pos": 354, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-MMU-9640195", "name": "RRAGA,B hydrolyzes GTP", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "lysosomal membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9JLN9-1", "P58043-1", "Q99K70-1", "Q8BXK4-1", "Q7TT45-1", "P50516-1", "Q6NTA4-1", "Q80X95-1", "P58006-1" ], "evidence": [ { "id": "R-MMU-9640195", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9640195" } ] }, { "id": "R-MMU-9640254", "name": "BMT2 (SAMTOR) binds S-adenosylmethionine and dissociates from KICSTOR:GATOR1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "lysosomal membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8BXK4-1" ], "evidence": [ { "id": "R-MMU-9640254", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9640254" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P50516", "gene_name": "Atp6v1a", "activity": [ { "ec_number": "7.1.2.2", "activity": "ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate.", "evidence": [ { "id": "P50516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50516" } ] }, { "ec_number": "7.1.2.2", "activity": "", "evidence": [ { "id": "P50516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50516" } ] } ] }, { "uniprot_ac": "P58006", "gene_name": "Sesn1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P58006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58006" } ] } ] }, { "uniprot_ac": "P58043", "gene_name": "Sesn2", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P58043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58043" } ] } ] }, { "uniprot_ac": "Q6NTA4", "gene_name": "Rragb", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6NTA4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NTA4" } ] } ] }, { "uniprot_ac": "Q7TT45", "gene_name": "Rragd", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q7TT45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TT45" } ] } ] }, { "uniprot_ac": "Q80X95", "gene_name": "Rraga", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q80X95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80X95" } ] } ] }, { "uniprot_ac": "Q8BXK4", "gene_name": "Bmt2", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q8BXK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BXK4" } ] } ] }, { "uniprot_ac": "Q99K70", "gene_name": "Rragc", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q99K70", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99K70" } ] } ] }, { "uniprot_ac": "Q9JLN9", "gene_name": "Mtor", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9JLN9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLN9" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q9JLN9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLN9" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }