{ "uniprot_canonical_ac": "Q8BQ47-1", "uniprot_ac": "Q8BQ47", "uniprot_id": "CNPY4_MOUSE", "mass": { "chemical_mass": 28094.0, "monoisotopic_mass": 28094.0 }, "refseq": { "ac": "NP_848727", "name": "protein canopy homolog 4 isoform 2 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848727" }, "gene_names": [ { "name": "Cnpy4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8BQ47", "id": "Q8BQ47" }, { "name": "2610019P18Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848727", "id": "NP_848727" }, { "name": "Cnpy4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848727", "id": "NP_848727" }, { "name": "Prat4b", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q8BQ47", "id": "Q8BQ47" } ], "protein_names": [ { "name": "Protein canopy homolog 4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8BQ47" }, { "name": "Protein associated with Tlr4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8BQ47" }, { "name": "protein canopy homolog 4 isoform 2 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848727", "id": "NP_848727" }, { "name": "protein canopy homolog 4; protein associated with Tlr4; canopy 4 homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848727", "id": "NP_848727" } ], "function": [ { "annotation": "Plays a role in the regulation of the cell surface expression of TLR4.", "evidence": [ { "database": "UniProtKB", "id": "Q8BQ47", "url": "https://www.uniprot.org/uniprot/Q8BQ47#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BQ47", "url": "https://www.uniprot.org/uniprot/Q8BQ47" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Cnpy4", "url": "https://www.uniprot.org/uniprot/Q8BQ47", "locus": { "chromosome": "5", "start_pos": 138192180, "end_pos": 138185747, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000036968", "url": "https://www.ensembl.org/id/ENSMUSG00000036968" } ] } } ], "crossref": [ { "id": "ENSMUSG00000036968", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000036968", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "66455", "url": "https://www.ncbi.nlm.nih.gov/gene/66455", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q8BQ47", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q8BQ47*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR021852", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021852", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:66455", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66455", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1913705", "url": "http://www.informatics.jax.org/marker/MGI:1913705", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "QYNVHAE", "url": "https://omabrowser.org/oma/group/QYNVHAE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2910833at2759", "url": "http://www.orthodb.org/?query=2910833at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15382", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15382", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15382:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15382:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF11938", "url": "http://pfam.xfam.org/family/PF11938", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8BQ47", "url": "http://purl.obolibrary.org/obo/PR_Q8BQ47", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_848727", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848727", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "D3Z0T5", "url": "https://www.uniprot.org/uniprot/D3Z0T5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z0T5-1", "url": "https://www.uniprot.org/uniprot/D3Z0T5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8BQ47", "url": "https://www.uniprot.org/uniprot/Q8BQ47", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8BQ47-1", "url": "https://www.uniprot.org/uniprot/Q8BQ47-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MCGLRFIMGPVRLEILLFILAAYGAWAEATKEEEDDTERLPSKCEVCKLLSMELQEALSRTGRSREVLELGQVLDTGKRKRHVPYSLSETRLEEALENLCERILDYNVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTFLKKQCETMLEEFEDVVGDWYFHHQEQPLQHFLCERHVLPASETACLREAWTGKEKISDGQEEADDEEEEEEEEITKTSGNPKHDPEDL", "length": 245, "header": "sp|Q8BQ47-1|CNPY4_MOUSE Isoform 1 of Protein canopy homolog 4 OS=Mus musculus OX=10090 GN=Cnpy4 PE=1 SV=1 CANONICAL=Q8BQ47-1" }, "isoforms": [ { "isoform_ac": "D3Z0T5-1", "url": "", "sequence": { "sequence": "MFMCLGSMSRRWVACLVGCLSSSFPSSISLLPVCKLLSMELQEALSRTGRSREVLELGQVLDTGKRKRHVPYSLSETRLEEALENLCERILDYNVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTFLKKQCETMLEEFEDVV", "length": 160, "header": "tr|D3Z0T5-1|D3Z0T5_MOUSE Computationally mapped isoform of Canopy FGF signaling regulator 4 OS=Mus musculus OX=10090 GN=Cnpy4 PE=1 SV=1 CANONICAL=Q8BQ47-1" }, "locus": { "chromosome": "5", "start_pos": 138190858, "end_pos": 138188435, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000110932.2", "url": "https://www.ensembl.org/id/ENSMUST00000110932.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000106557.2", "url": "https://www.ensembl.org/id/ENSMUSP00000106557.2" } ] } }, { "isoform_ac": "Q8BQ47-1", "url": "", "sequence": { "sequence": "MCGLRFIMGPVRLEILLFILAAYGAWAEATKEEEDDTERLPSKCEVCKLLSMELQEALSRTGRSREVLELGQVLDTGKRKRHVPYSLSETRLEEALENLCERILDYNVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTFLKKQCETMLEEFEDVVGDWYFHHQEQPLQHFLCERHVLPASETACLREAWTGKEKISDGQEEADDEEEEEEEEITKTSGNPKHDPEDL", "length": 245, "header": "sp|Q8BQ47-1|CNPY4_MOUSE Isoform 1 of Protein canopy homolog 4 OS=Mus musculus OX=10090 GN=Cnpy4 PE=1 SV=1 CANONICAL=Q8BQ47-1" }, "locus": { "chromosome": "5", "start_pos": 138191160, "end_pos": 138185847, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000110934", "url": "https://www.ensembl.org/id/ENSMUST00000110934" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000106559", "url": "https://www.ensembl.org/id/ENSMUSP00000106559" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "A molecule that is associated with Toll-like receptor 4 and regulates its cell surface expression.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2006", "authors": "Konno K, Wakabayashi Y, Akashi-Takamura S, Ishii T, Kobayashi M, Takahashi K, Kusumoto Y, Saitoh S, Yoshizawa Y, Miyake K", "evidence": [ { "database": "UniProtKB", "id": "Q8BQ47", "url": "https://www.uniprot.org/uniprot/Q8BQ47" } ], "reference": [ { "type": "PubMed", "id": "16338228", "url": "https://glygen.org/publication/PubMed/16338228" } ] } ], "pathway": [ { "id": "mmu:66455", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66455", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8N129-1", "protein_name": "Protein canopy homolog 4", "gene_name": "CNPY4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGPVRLGILLFLFLAVHEAWAGMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL", "length": 248 }, "evidence": [ { "id": "45227978", "url": "http://www.informatics.jax.org/homology/45227978", "database": "MGI" }, { "id": "Q8BQ47", "url": "https://omabrowser.org/oma/group/Q8BQ47/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "Q8BQ47", "url": "https://www.uniprot.org/uniprot/Q8BQ47" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q8BQ47", "url": "https://www.uniprot.org/uniprot/Q8BQ47" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "regulation of protein localization", "id": "GO:0032880", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032880", "evidence": [ { "database": "UniProtKB", "id": "Q8BQ47", "url": "https://www.uniprot.org/uniprot/Q8BQ47" } ], "pmid": "" }, { "name": "positive regulation of protein localization to plasma membrane", "id": "GO:1903078", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903078", "evidence": [ { "database": "UniProtKB", "id": "Q8BQ47", "url": "https://www.uniprot.org/uniprot/Q8BQ47" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }